| Protein: 328789112 XP_003251231.1 PREDICTED: kynurenine--oxoglutarate transaminase 1 mitochondrial-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 35 | 37.5 | 27.5 | 1.2727273 | 1.3636364 |
| Scape | 20.1 | 49 | 30.9 | 0.65048546 | 1.5857605 |
| Brain | |||||
| Crop | 28.6 | 71.4 | 0.40056023 | ||
| Eye | 56.8 | 43.2 | 1.3148148 | ||
| Intestine | 28.5 | 36.2 | 35.2 | 0.80965906 | 1.0284091 |
| Leg, front | 31.9 | 41.9 | 26.2 | 1.2175573 | 1.5992366 |
| Leg, middle | 29.4 | 42.2 | 28.4 | 1.0352113 | 1.4859155 |
| Leg, rear | 56.5 | 27.7 | 15.9 | 3.5534592 | 1.7421384 |
| Mandibular gland | 50.2 | 49.8 | 1.0080321 | ||
| Rectum | |||||
| Salivary gland, cerebral | 90.3 | 9.7 | 9.3092785 | ||
| Salivary gland, thoracic | 33.6 | 27.2 | 39.2 | 0.85714287 | 0.6938776 |
| Sternite | 18 | 49.4 | 32.5 | 0.5538462 | 1.52 |
| Tergite | 4.6 | 67.4 | 28.1 | 0.16370107 | 2.3985765 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 30.6 | 21.6 | 47.8 | 0.64016736 | 0.45188284 |
| Malpighian tubules | 22.7 | 41.2 | 36.1 | 0.62880886 | 1.1412742 |
| Nerve chord | 17.6 | 65 | 17.3 | 1.017341 | 3.7572255 |
| Poison sac | |||||
| Sting | 50.3 | 49.7 | 1.0120724 | ||
| Heart | 17.7 | 33.7 | 48.6 | 0.36419752 | 0.69341564 |
| Hypopharyngeal gland | 60.7 | 39.3 | 1.5445293 | ||
| Galea | 9.8 | 56.4 | 33.8 | 0.28994083 | 1.6686391 |
| Glossa | 32.3 | 40 | 27.8 | 1.1618705 | 1.438849 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.1 | 43.8 | 35.2 | 0.88352275 | 1.2443181 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFIKVNFSTTSKISYTLSTLKNIQKSVVMSKFDLPDRLKGNEKSVWVEYIQLALKYKPLV NLGQGFPDFHAPENVTKALADSATSENPLLNQYTRGFGHPRLVNVVAKLYSKLLNRTLDP I |
 Top
| |