| Protein: 110763831 XP_393344.3 PREDICTED: hypothetical protein LOC409854 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 50.6 | 49.4 | 1.0242915 | ||
| Scape | 40.1 | 26.5 | 33.3 | 1.2042042 | 0.7957958 |
| Brain | |||||
| Crop | 38.7 | 61.3 | 0.6313214 | ||
| Eye | |||||
| Intestine | 39.6 | 12.2* | 48.2 | 0.8215768 | 0.25311202 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 39.8 | 48.8* | 11.3 | 3.5221238 | 4.318584 |
| Salivary gland, thoracic | 50.2 | 49.8 | 1.0080321 | ||
| Sternite | 37.6 | 26.5 | 35.9 | 1.0473537 | 0.73816156 |
| Tergite | 78.4 | 21.6 | 3.6296296 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 46.5 | 30.9 | 22.6 | 2.057522 | 1.3672566 |
| Malpighian tubules | 35.9 | 24.6 | 39.5 | 0.90886074 | 0.6227848 |
| Nerve chord | 53 | 9.9 | 37 | 1.4324324 | 0.26756757 |
| Poison sac | |||||
| Sting | 52.1 | 47.9 | 1.0876827 | ||
| Heart | 39.9 | 29.3 | 30.8 | 1.2954545 | 0.9512987 |
| Hypopharyngeal gland | 33.6 | 66.4 | 0.5060241 | ||
| Galea | 34 | 26.5 | 39.5 | 0.8607595 | 0.6708861 |
| Glossa | 29.5 | 28.8 | 41.7 | 0.70743406 | 0.6906475 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 43.1 | 32.6 | 39.8 | 1.0829146 | 0.8190955 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MADPEKQPEQPKAGQQKLIIANKVTGTVKWFNVKSGYGFINRNDTKEDVFVHQSAIVKNN PRKAVRSVGDGEVVEFDVVIGEKGHEAANVTGPSGEAVKGSPYAADKRRGYRGGHWYISQ RRGNTRTQRRPREGQDGYETGEGKTGDEGNVGEGGGQQRRYRVRRQYDGYYRGSRRSGPS AQQQGDNSGEGGEQGGETGGDGGVPRGGGRGRGGPSRRYFRRNFRGGRGGGPPRRPRSQD GQVKSEQKSDAPKDKDALVDVPAPQESQPVQNTTTESTA |
 Top
| |