| Protein: 328780987 XP_623370.2 PREDICTED: microtubule-associated protein RP/EB family member 1-like isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 42.8 | 57.2 | 0.74825174 | ||
| Scape | 42.3 | 23.6 | 34.2 | 1.2368422 | 0.69005847 |
| Brain | |||||
| Crop | 38.2 | 61.8 | 0.618123 | ||
| Eye | |||||
| Intestine | 42.7 | 57.3 | 0.7452007 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 47.5 | 52.5 | 0.9047619 | ||
| Salivary gland, thoracic | 45.7 | 54.3 | 0.8416206 | ||
| Sternite | 56.5 | 31.9 | 11.6 | 4.87069 | 2.75 |
| Tergite | 88.6 | 11.4 | 7.7719297 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 38.2 | 61.8 | 0.618123 | ||
| Malpighian tubules | 41.2 | 36.7 | 22.1 | 1.8642534 | 1.6606334 |
| Nerve chord | 38.7 | 25 | 36.3 | 1.0661157 | 0.6887052 |
| Poison sac | |||||
| Sting | |||||
| Heart | 50.2 | 22.4 | 27.4 | 1.8321168 | 0.81751823 |
| Hypopharyngeal gland | 43.2 | 56.8 | 0.7605634 | ||
| Galea | 18.6* | 81.4 | 0.22850123 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 52.1 | 34.1 | 44.7 | 1.1655481 | 0.7628635 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAVNVYATNVTTENLSRHDMLAWVNDCLQSSFTKIEELCTGAVYCQFMDMLFPGSVPLKR VKFKTNLEHEYIQNFKILQGGFKKMNVDKIVPIDKLVKGRFQDNFEFLQWFKKFFDANYS RTEPYDALAMRGGEPMGSGGSNAPHGTNTKRTTPRDVNSAKPAARIGKTHTTDLPVPTLN DTLTKAPAHRPQAKTGVGNRGEAGKVEELSAQVMELKMSLEGLEKERDFYFGKLRDIEVM CQDCDNGDPPPIVQKILEVLYATEEGFAPPEELEGDGLAPDDEEEY |
 Top
| |