| Protein: 328789546 XP_001120819.2 PREDICTED: MOSC domain-containing protein 2 mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 42.2 | 57.8 | 0.7301038 | ||
| Scape | 31.8 | 68.2 | 0.46627566 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 16.1 | 25.4 | 58.6 | 0.27474403 | 0.4334471 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 72.1 | 27.9 | 2.5842295 | ||
| Mandibular gland | 16.1 | 83.9 | 0.19189511 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 25.6 | 38.5 | 35.9 | 0.7130919 | 1.0724233 |
| Sternite | 9.4 | 13.5* | 77.1 | 0.12191959 | 0.17509727 |
| Tergite | 3.3 | 96.7 | 0.034126163 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 9.8 | 19.5 | 70.6 | 0.1388102 | 0.27620396 |
| Malpighian tubules | 26 | 26 | 48 | 0.5416667 | 0.5416667 |
| Nerve chord | 28.6 | 40.9 | 30.5 | 0.9377049 | 1.3409836 |
| Poison sac | |||||
| Sting | |||||
| Heart | 5.3 | 52.7 | 42 | 0.12619047 | 1.2547619 |
| Hypopharyngeal gland | 50.7 | 49.3 | 1.0283976 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 18.2 | 37.1 | 57.4 | 0.31707317 | 0.64634144 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MIMDDRTRLTYVSAAVVGAGTVVVFLWWWWWSKRQKEKPPSRWRKVGELSDLVVYPVKSL GPVRMNTMECTKLGLKSGWLRDRTLMVIDLNGHFVTGRQNPKMVQVIPKVSGTILTLSAP GMISLSIDLSRIQGKGFRVAVWGQPVFTRDCGEEAARWLSRFLLQEDTGFRLVYYPLDYP TREIRKSNRQWLLTPDDTGAYPDATSYCLINEASVTDLNTRLEKPVNPEQFRPNFVIKGA SAYEEDTWGWVKIGDVIFKTVMPCTRCIFTTVDPETGTKNPKAEPLKTLKSYRQIMDPII RPLVGESPVLGIHLGLRNSDGIVRVGDPVYVGLPEEQPLLISPP |
 Top
| |