| Protein: 217330555 NP_001136081.1 carboxylesterase |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 8.6* | 44.1 | 47.2 | 0.1822034 | 0.93432206 |
| Scape | 4.2* | 69.6 | 26.2 | 0.16030535 | 2.6564887 |
| Brain | |||||
| Crop | 14.9 | 57.8 | 27.3 | 0.5457876 | 2.117216 |
| Eye | |||||
| Intestine | 69.1* | 17.8 | 13.1 | 5.2748094 | 1.3587786 |
| Leg, front | 16.8 | 60.6 | 22.6 | 0.74336284 | 2.681416 |
| Leg, middle | 16.7 | 57.4 | 25.9 | 0.64478767 | 2.2162163 |
| Leg, rear | 70.7 | 15.7 | 13.6 | 5.1985292 | 1.1544118 |
| Mandibular gland | 12.1 | 87.9 | 0.13765644 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 0.8* | 90.3* | 8.9 | 0.08988764 | 10.146068 |
| Sternite | 83.8 | 16.2 | 5.1728396 | ||
| Tergite | 2.3 | 75.5 | 22.3 | 0.10313901 | 3.3856502 |
| Ventriculus | 17 | 21.1 | 61.9 | 0.2746365 | 0.34087238 |
| Thoracic muscle | |||||
| Fat body | 12.2 | 40 | 47.8 | 0.25523013 | 0.83682007 |
| Malpighian tubules | 18.8 | 49.5 | 31.7 | 0.59305996 | 1.5615141 |
| Nerve chord | 96.1* | 3.9 | 24.641026 | ||
| Poison sac | |||||
| Sting | 35 | 65 | 0.53846157 | ||
| Heart | 3.5* | 52.6 | 43.9 | 0.07972665 | 1.1981777 |
| Hypopharyngeal gland | 73.5 | 26.5 | 2.7735848 | ||
| Galea | 23.5 | 76.5 | 0.30718955 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 19.4 | 55.3 | 35.2 | 0.5511364 | 1.5710227 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNKQIVTVKQGKLAGAVLKSALGSLYIAFREIPFAAPPIGDLRFKDPQPPQPWTGIKDTS QLKTYICSQQEEVEPFKFFGNEDCLYLNVYTNSLNQSKPVMFWIHGGAFVVGNSSFQKGS RPDYLLAKDVVVVSTNYRLGAFGFLNLGHRVAPGNQGLKDIIAALKWVKENISNFGGDPN NVTIFGVSAGGVLVHSLLLSPCARGLFHKAIMHSGSIRCSWAMNQSLPERGFKLASLLGK DSCDPEEVVKFLRTVPAEDIVKAQASVLTREETLSHNLAFGINNDEVAENPVLPEPIEQL LKKDADVPVIISYTSHEFIMFMKDISEKSLSIYNEYLPTHVKTLGTLKKLGDEEIKNLFN VVKDRYFEGKPIDKEKLYGLSNFMTDTFFGIPAILMLEDRVKRLTAPNYFCKFSYIGNEK TSTDLLVTRHISGASHVDDIAYLLYLPKCKTENPDPPAVGTKDRITLERMTRMWTNFAKT GQPTSIQDEFVNVNWKPATANDLCYLDIGNELCLLPLPSHLLSSKLS |
 Top
| |