| Protein: 209180477 NP_001129207.1 lambda crystallin-like protein |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 21.1 | 40 | 38.9 | 0.54241645 | 1.0282776 |
| Scape | 26.3 | 53.1* | 20.6 | 1.2766991 | 2.5776699 |
| Brain | 4.8* | 73.1* | 22.1 | 0.21719457 | 3.3076923 |
| Crop | 20.8 | 56.5* | 22.7 | 0.9162996 | 2.4889867 |
| Eye | 82.5* | 17.5 | 4.714286 | ||
| Intestine | 55.9* | 26.7 | 17.4 | 3.2126436 | 1.5344827 |
| Leg, front | 31.4* | 57.7* | 10.9 | 2.880734 | 5.293578 |
| Leg, middle | 31.2* | 56.9* | 11.9 | 2.6218488 | 4.7815127 |
| Leg, rear | 89.2* | 7.2 | 3.6 | 24.777779 | 2 |
| Mandibular gland | 84.3 | 15.7 | 5.3694267 | ||
| Rectum | 45.6 | 54.4 | 0.8382353 | ||
| Salivary gland, cerebral | 98.8* | 0.6 | 0.7 | 141.14285 | 0.85714287 |
| Salivary gland, thoracic | 4.7* | 67.7 | 27.7 | 0.1696751 | 2.4440434 |
| Sternite | 9.4 | 28.6 | 62 | 0.15161291 | 0.46129033 |
| Tergite | 1.9 | 66.2 | 31.9 | 0.05956113 | 2.0752351 |
| Ventriculus | 11.5 | 64.5 | 24 | 0.47916666 | 2.6875 |
| Thoracic muscle | |||||
| Fat body | 15.6 | 43.6 | 40.8 | 0.38235295 | 1.0686275 |
| Malpighian tubules | 46.3* | 33.3 | 20.4 | 2.2696078 | 1.632353 |
| Nerve chord | 1.1 | 94.1* | 4.7 | 0.23404256 | 20.021276 |
| Poison sac | |||||
| Sting | 50.2 | 49.8 | 1.0080321 | ||
| Heart | 5.3 | 58.2 | 36.5 | 0.14520548 | 1.5945206 |
| Hypopharyngeal gland | 63.5 | 36.5 | 1.7397261 | ||
| Galea | 38.1 | 36.4 | 25.5 | 1.4941176 | 1.427451 |
| Glossa | 61.4* | 19.7 | 19 | 3.231579 | 1.0368421 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.6 | 49.1 | 25.6 | 1.3125 | 1.9179688 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSFKNEKIGIIGSGLIGRSWSMLFASVGYEVIIYDIVKEQITRALEDIHQQLKHLENSGL LRGSLTAEQQFKLIKGSTNLIEVVKGVKLIQECVPENLPLKLKLYNELDNLVDDKVILSS STSTFRPSLLSENLKHREQVIVSHPVNPPYYVPLVEIVPAPWTRAEIPLQVKAIMTEIGQ TPVVLTREIDGFVLNRIQYAILNEAWRLVADGILNAKDVDAVMSEGLGMRYAFLGAFEAA HLNAEGMKKYCETYKNSIYDVSMTFGPVPKFEGEMAEKISNELNEMCPLEKLKERRIWRD DALTKLSLLKKELNKKK |
 Top
| |