| Protein: 328784183 XP_392811.2 PREDICTED: probable isocitrate dehydrogenase [NAD] subunit alpha mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 26.8 | 34.7 | 38.5 | 0.6961039 | 0.9012987 |
| Scape | 21.9 | 31.9 | 46.2 | 0.47402596 | 0.6904762 |
| Brain | 50.6 | 49.4 | 1.0242915 | ||
| Crop | 19.5 | 45.7 | 34.8 | 0.5603448 | 1.3132184 |
| Eye | 11.3 | 41.2 | 47.5 | 0.23789474 | 0.8673684 |
| Intestine | 27.8 | 27.6 | 44.6 | 0.6233184 | 0.6188341 |
| Leg, front | 34.9 | 23.5 | 41.6 | 0.8389423 | 0.56490386 |
| Leg, middle | 32.3 | 28.1 | 39.5 | 0.81772155 | 0.7113924 |
| Leg, rear | 22.4 | 27.9 | 49.7 | 0.45070422 | 0.5613682 |
| Mandibular gland | 79.6 | 20.4 | 3.9019608 | ||
| Rectum | 26.2 | 73.8 | 0.35501355 | ||
| Salivary gland, cerebral | 27.2 | 25.8 | 47.1 | 0.5774947 | 0.5477707 |
| Salivary gland, thoracic | 26.3 | 45.9 | 27.7 | 0.9494585 | 1.6570398 |
| Sternite | 42.2 | 44.3 | 13.5 | 3.125926 | 3.2814815 |
| Tergite | 59.7 | 16.4 | 23.8 | 2.5084033 | 0.68907565 |
| Ventriculus | |||||
| Thoracic muscle | 6.8 | 48.3 | 44.9 | 0.15144765 | 1.0757239 |
| Fat body | 33.4 | 50.3 | 16.3 | 2.0490797 | 3.0858896 |
| Malpighian tubules | 37.5 | 34.1 | 28.4 | 1.3204225 | 1.2007042 |
| Nerve chord | 28.8 | 35.9 | 35.3 | 0.815864 | 1.0169972 |
| Poison sac | |||||
| Sting | 39.4 | 60.6 | 0.650165 | ||
| Heart | 50.3 | 14.9 | 34.9 | 1.4412607 | 0.4269341 |
| Hypopharyngeal gland | 92.4 | 7.6 | 12.157895 | ||
| Galea | 39.1 | 23.2 | 37.7 | 1.0371352 | 0.61538464 |
| Glossa | 42.7 | 22.4 | 34.9 | 1.2234957 | 0.6418338 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.2 | 36.6 | 37.5 | 0.88533336 | 0.976 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MADQGNAKPHRKLLRRHCFAGTNHKCDSFLVFGVGSTCALLWVVEVRVFIVKFTVRMAAQ WIRNAVPKIGCVRFYSSKVHKCTLIPGDGIGPEISIAVQKIFDAAKVPIEWESVDVTPVK GPDGKFGIPQAAIDSVNRNKIGLKGPLMTPVGKGHRSLNLALRKEFNLYANVRPCRSLEG YKTLYDNVDVVTIRENTEGEYSGIEHEIVEGVVQSIKLITEEASSRVAEFAFQYAQDNNR KKVTAVHKANIMRMSDGLFLRCCREAAQKFQSIKFEERYLDTVCLNMVQDPSQYDVLVMP NLYGDILSDMCAGLVGGLGLTPSGNIGLNGALFESVHGTAPDIAGQDKANPTALLLSAVM MLKYMGLNKHAKIIETCAYETIKEGKHLTGDLGGSAKCSEYTDEICKKVLSLAK |
 Top
| |