| Protein: 48141571 XP_393558.1 PREDICTED: phosphoglycolate phosphatase-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 29.4 | 38.4 | 32.2 | 0.9130435 | 1.1925466 |
| Scape | 25.5 | 37.1 | 37.5 | 0.68 | 0.98933333 |
| Brain | 41.6 | 58.4 | 0.7123288 | ||
| Crop | 24.2 | 21.5 | 54.3 | 0.44567218 | 0.39594844 |
| Eye | 6.5 | 44.1 | 49.4 | 0.13157895 | 0.89271253 |
| Intestine | 19.6 | 39.1 | 41.2 | 0.47572815 | 0.94902915 |
| Leg, front | 29.4 | 36.6 | 33.9 | 0.86725664 | 1.079646 |
| Leg, middle | 30.8 | 34.8 | 34.4 | 0.89534885 | 1.0116279 |
| Leg, rear | 50.6 | 24.2 | 25.1 | 2.0159361 | 0.96414346 |
| Mandibular gland | 26.9 | 73.1 | 0.36798906 | ||
| Rectum | 24.4 | 22.2 | 53.4 | 0.45692885 | 0.41573033 |
| Salivary gland, cerebral | 65.1 | 3.1 | 31.8 | 2.04717 | 0.097484276 |
| Salivary gland, thoracic | 46.5 | 21.1 | 32.4 | 1.4351852 | 0.65123457 |
| Sternite | 28.1 | 45.8 | 26.1 | 1.0766283 | 1.7547892 |
| Tergite | 39.7 | 60.3 | 0.6583748 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 32.6 | 42.3 | 25.2 | 1.2936507 | 1.6785715 |
| Malpighian tubules | 37.7 | 29.5 | 32.8 | 1.1493902 | 0.8993902 |
| Nerve chord | 23.9 | 42.3 | 33.7 | 0.70919883 | 1.2551929 |
| Poison sac | |||||
| Sting | 63.7 | 36.3 | 1.754821 | ||
| Heart | 35.1 | 28.1 | 36.7 | 0.95640326 | 0.76566756 |
| Hypopharyngeal gland | 62.1 | 37.9 | 1.6385224 | ||
| Galea | 68.8* | 18.5 | 12.7 | 5.4173226 | 1.4566929 |
| Glossa | 22.4 | 50 | 27.5 | 0.81454545 | 1.8181819 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.4 | 35.5 | 38.5 | 0.8675325 | 0.9220779 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKTKSILSLSNVEFKTLMDSIDVVLSDCDGVLWRETEVIQNSPETVKKLKELGKKFFYIT NNNTKTRAEFLKKCNDLNYDATIDEIVCTSFLAAVYLKEKEFNKKVYVVGSVGIGKELEA VGIQHYGSGPDIIEGDEVELVKNFKPDPEVGAVVIGFDKDFSFPKIVKAVTYLNDPNVHF IGTNNDIERPSPSANKFPGTGCFIKNIEAACNRSAVILGKPESFVSEYITKKYGLNPERT LMIGDNCNTDILLGKRCGFKTLVVLTGITTQNDIENMNASDINTKNLIIPDYYANELGDI LEMIKIS |
 Top
| |