| Protein: 66525285 XP_392071.2 PREDICTED: 60S ribosomal protein L4 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 9* | 40.9 | 50 | 0.18 | 0.818 |
| Scape | 44.8 | 32.4 | 22.8 | 1.9649123 | 1.4210526 |
| Brain | |||||
| Crop | 31.7 | 34.1 | 34.2 | 0.92690057 | 0.99707603 |
| Eye | 4.3* | 95.7 | 0.04493208 | ||
| Intestine | 17.3 | 47.2 | 35.5 | 0.48732394 | 1.3295774 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | 64.1 | 35.9 | 1.7855153 | ||
| Salivary gland, cerebral | 68.5 | 9.7 | 21.9 | 3.1278539 | 0.44292238 |
| Salivary gland, thoracic | 31.4 | 30 | 38.6 | 0.8134715 | 0.77720207 |
| Sternite | 16.9 | 42.5 | 40.6 | 0.41625616 | 1.046798 |
| Tergite | 2.2 | 93.5* | 4.3 | 0.5116279 | 21.744186 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 30.8 | 34.1 | 35.1 | 0.8774929 | 0.97151 |
| Malpighian tubules | 34.8 | 25.2 | 40 | 0.87 | 0.63 |
| Nerve chord | 51.1 | 12.2 | 36.7 | 1.3923706 | 0.33242506 |
| Poison sac | |||||
| Sting | 55.7 | 44.3 | 1.2573364 | ||
| Heart | 17.5 | 48.4 | 34.1 | 0.51319647 | 1.4193548 |
| Hypopharyngeal gland | 16.6 | 83.4 | 0.19904077 | ||
| Galea | 27.1 | 41.3 | 31.6 | 0.8575949 | 1.306962 |
| Glossa | 26 | 26.2 | 47.8 | 0.54393303 | 0.54811716 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.8 | 36.9 | 40.7 | 0.73218673 | 0.9066339 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSLSTARPLVTIYTDKNESSGDTISLPAVFKAPIRPDIVNFVHQQVSKNSRQPYCVSKEA GHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHRRINVN QKRYAMVSAIAASGVPALVQSKGHMVQEIPELPLVVSDKIQEYNKTKQAVIFLRRIKAWN DIQKVYKSQRFRAGKGKMRNRRRIQRRGPLIVYHQDQGIRKAFRNIPGVDLMNINKMNLL KLAPGGHVGRFVIWTKSAFEKLDALYGTWRKESQLKADYNLPFPKMMNTDLSRLLKSQEI RKVLRAPRKKVVRRVKKLNPLSNTRAMLRLNPYAAVLKRAAILTARKRQQERELALAEKR GVKLPKSTPAVKTKLLLERRRKQILAARAAKPKKAVKAKSATSAAKPAKTTKASEKSAKS SQKAAPAKK |
 Top
| |