| Protein: 110767200 XP_397446.3 PREDICTED: mitochondrial glutamate carrier 1-like partial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 50.5 | 9.4 | 40.2 | 1.2562189 | 0.23383084 |
| Brain | |||||
| Crop | 26.7 | 56.8* | 16.6 | 1.6084337 | 3.4216866 |
| Eye | |||||
| Intestine | 16.3* | 83.7 | 0.19474313 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 32.6 | 22.2 | 45.3 | 0.7196468 | 0.49006623 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 54 | 46 | 1.173913 | ||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 7.4 | 51.3 | 41.3 | 0.17917675 | 1.2421308 |
| Hypopharyngeal gland | 76.5 | 23.5 | 3.255319 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.3 | 40.9 | 42.4 | 0.6910377 | 0.9646226 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
FDCFNKTYKAEGYFGLYKGSGVNILLITPEKAIKLTANDTFRHYLSIGSGQKLPLEREML AGGLAGACQIIVTTPMELLKIQMQDAGRIAIAAKEAGKTISKISALSLTKDLLRKRGILG LYQGTGATALRDVTFSILYFPLFARLNNIGPKRDDGSSVFWCSFLAGCTAGSIAALSVNP FDVIKTRLQVIKKAPGEPTYNGVLDCITKTLKNEGPIAFFKGGACRMIVIAPLFGIAQTV YYLGVAEWLLGFK |
 Top
| |