| Protein: 48138819 XP_393426.1 PREDICTED: vesicle-associated membrane protein/synaptobrevin-binding protein |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 38.5 | 24.5 | 37 | 1.0405406 | 0.6621622 |
| Scape | 35.4 | 19.5 | 45.1 | 0.7849224 | 0.4323725 |
| Brain | 30.6 | 69.4 | 0.4409222 | ||
| Crop | 42.1 | 31.8 | 26.1 | 1.6130269 | 1.2183908 |
| Eye | |||||
| Intestine | 21.4 | 46.5 | 32.2 | 0.66459626 | 1.4440994 |
| Leg, front | 35.1 | 29.9 | 35 | 1.0028571 | 0.8542857 |
| Leg, middle | 28.6 | 42.4 | 29 | 0.9862069 | 1.4620689 |
| Leg, rear | 23.8 | 38.9 | 37.3 | 0.6380697 | 1.0428954 |
| Mandibular gland | 2.6 | 57.9 | 39.5 | 0.06582279 | 1.4658228 |
| Rectum | 8.5 | 61.3 | 30.2 | 0.28145695 | 2.0298014 |
| Salivary gland, cerebral | 27 | 59* | 14.1 | 1.9148936 | 4.184397 |
| Salivary gland, thoracic | 43.5 | 20.4 | 36.1 | 1.2049861 | 0.565097 |
| Sternite | 21.2 | 23.2 | 55.6 | 0.38129497 | 0.4172662 |
| Tergite | 83.4 | 16.6 | 5.0240965 | ||
| Ventriculus | 33.6 | 36.9 | 29.4 | 1.1428572 | 1.255102 |
| Thoracic muscle | |||||
| Fat body | 45.1 | 29.9 | 25 | 1.804 | 1.196 |
| Malpighian tubules | 34.4 | 28.7 | 36.9 | 0.9322493 | 0.7777778 |
| Nerve chord | 18.2 | 48 | 33.8 | 0.53846157 | 1.4201183 |
| Poison sac | |||||
| Sting | 51.5 | 48.5 | 1.0618557 | ||
| Heart | 39.5 | 32 | 28.5 | 1.3859649 | 1.122807 |
| Hypopharyngeal gland | 29.5 | 70.5 | 0.41843972 | ||
| Galea | 34.7 | 20.8 | 44.5 | 0.77977526 | 0.46741572 |
| Glossa | 25.6 | 21.1 | 53.3 | 0.4803002 | 0.3958724 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.1 | 35.6 | 38 | 0.8447368 | 0.9368421 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVKPEQILIIEPRSELRFRGPFTERTVTSYIKLTNPSNHKVYFKIKTTAPKRYCVRPNCG YLKPKEISQIAVTLQPFDFDPAEKNKHKFMVQALVAQDNDDEENPDMWKGIDPEQLMESK LKCVFENPVIKTMTADTTKSDVTTNNGKNKGVGDSVKSLPKVPGETEEKLIKAAQEVNQL REEESALRQENLQLKEDLLHLRNAMLVNEATLATKNINSQNSSESSPPVISILIAVLMVI VGYVLGKMI |
 Top
| |