| Protein: 66506786 XP_394487.2 PREDICTED: malate dehydrogenase cytoplasmic-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 31 | 36.3 | 32.6 | 0.9509202 | 1.1134969 |
| Scape | 23.9 | 46.5 | 29.6 | 0.8074324 | 1.570946 |
| Brain | 34 | 26.3 | 39.7 | 0.8564232 | 0.6624685 |
| Crop | 39.3 | 23.9 | 36.8 | 1.0679348 | 0.6494565 |
| Eye | 38.6 | 32.8 | 28.6 | 1.3496504 | 1.1468531 |
| Intestine | 29.8 | 38.9 | 31.3 | 0.9520767 | 1.2428116 |
| Leg, front | 23.9 | 46.7 | 29.3 | 0.81569964 | 1.5938567 |
| Leg, middle | 27.3 | 43.2 | 29.5 | 0.92542374 | 1.4644067 |
| Leg, rear | 45.6 | 29.6 | 24.8 | 1.8387097 | 1.1935484 |
| Mandibular gland | 12.7 | 66 | 21.3 | 0.59624416 | 3.0985916 |
| Rectum | 64.7 | 19.1 | 16.2 | 3.993827 | 1.1790123 |
| Salivary gland, cerebral | 69.3 | 14.9 | 15.8 | 4.386076 | 0.943038 |
| Salivary gland, thoracic | 33.8 | 27.1 | 39.2 | 0.8622449 | 0.69132656 |
| Sternite | 32.3 | 43.7 | 24 | 1.3458333 | 1.8208333 |
| Tergite | 18.8 | 54.8 | 26.3 | 0.7148289 | 2.08365 |
| Ventriculus | 23.4 | 34.9 | 41.7 | 0.5611511 | 0.83693045 |
| Thoracic muscle | |||||
| Fat body | 34.2 | 33.6 | 32.2 | 1.0621119 | 1.0434783 |
| Malpighian tubules | 31.4 | 32.5 | 36.1 | 0.8698061 | 0.900277 |
| Nerve chord | 19.3 | 60.9 | 19.8 | 0.9747475 | 3.0757575 |
| Poison sac | |||||
| Sting | 51.2 | 48.8 | 1.0491803 | ||
| Heart | 22.6 | 44.6 | 32.8 | 0.6890244 | 1.3597561 |
| Hypopharyngeal gland | 59.9 | 40.1 | 1.4937656 | ||
| Galea | 35 | 34.3 | 30.7 | 1.1400652 | 1.1172638 |
| Glossa | 27.9 | 41.3 | 30.7 | 0.90879476 | 1.3452768 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.7 | 39.3 | 30.7 | 1.0651466 | 1.2801303 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSEPINVVVTGAAGQIAYSLLYQLAAGTVFGPNQPINLRLLDIPVMMKVLDGVVMELEDL ALPLLREVVPTADPSVAFKNVAAAFLVGAMPRKEGMERKDLLAANVEIFKVQGEALDKYA QKDVKVLVVGNPANTNALICSHYAPSIPKENFTAMTRLDQNRAQAALSAKLNVQVDKVKN VIIWGNHSSTQYPDASHATVALQSSTKPISLAINDENWLNTTFVETIQKRGAAVIAARKM SSAMSAAKAAGDHMRDWWVGTKPGEWVSMGVLSDGSYGIPKDIVFSFPVTIENGQYKIVQ GLSINDFARSKLNITSNELEEERAEAKNVLHEK |
 Top
| |