| Protein: 66560571 XP_623750.1 PREDICTED: myotrophin-like isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 31.3 | 38.6 | 30 | 1.0433333 | 1.2866666 |
| Scape | 18 | 30.5 | 51.4 | 0.35019454 | 0.5933852 |
| Brain | |||||
| Crop | 35.7 | 64.3 | 0.55520993 | ||
| Eye | 58.8 | 41.2 | 1.4271845 | ||
| Intestine | 6.6* | 48.6 | 44.8 | 0.14732143 | 1.0848215 |
| Leg, front | 45* | 34.5 | 20.5 | 2.195122 | 1.6829268 |
| Leg, middle | 20.5 | 49.9 | 29.6 | 0.6925676 | 1.6858108 |
| Leg, rear | 61 | 39 | 1.5641025 | ||
| Mandibular gland | 0.9* | 99.1 | 0.009081736 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 55.4 | 11.7 | 33 | 1.6787878 | 0.35454544 |
| Sternite | 37 | 39.3 | 23.7 | 1.5611814 | 1.6582278 |
| Tergite | 66 | 34 | 1.9411764 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 38.1 | 38.9 | 23 | 1.6565218 | 1.6913043 |
| Nerve chord | 22.1 | 38.4 | 39.5 | 0.55949366 | 0.9721519 |
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 37.1 | 62.9 | 0.5898251 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.5 | 38.5 | 42.4 | 0.7900943 | 0.9080189 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSELVWGIKNGDLEQVRDIVENKNIDVNQMIDGRTPLHYAADYGQSEVVRYLLEKGANAN ATDKHGITTLLAAIWEGHTNCVKLLLEKGAKPDGLTPDGTSYLDAAEKDEIKQLLKFH |
 Top
| |