| Protein: 66504343 XP_623731.1 PREDICTED: 40S ribosomal protein S3 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 44.5 | 55.5 | 0.8018018 | ||
| Scape | 41.2 | 26.7 | 32.2 | 1.2795031 | 0.8291925 |
| Brain | |||||
| Crop | 16.6 | 45.7 | 37.7 | 0.44031832 | 1.2122016 |
| Eye | 66 | 34 | 1.9411764 | ||
| Intestine | 13.6 | 49.5 | 36.9 | 0.36856368 | 1.3414634 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 68.5 | 3.2 | 28.2 | 2.429078 | 0.11347517 |
| Salivary gland, thoracic | 33.6 | 28.3 | 38.1 | 0.88188976 | 0.7427822 |
| Sternite | 73.8 | 26.2 | 2.816794 | ||
| Tergite | 39.4 | 50.4 | 10.2 | 3.862745 | 4.9411764 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 30 | 44 | 26 | 1.1538461 | 1.6923077 |
| Malpighian tubules | 42 | 20.3 | 37.7 | 1.1140584 | 0.53846157 |
| Nerve chord | 47.7 | 11.6 | 40.7 | 1.1719902 | 0.28501227 |
| Poison sac | |||||
| Sting | 53.7 | 46.3 | 1.1598272 | ||
| Heart | 21.5 | 44.9 | 33.6 | 0.63988096 | 1.3363096 |
| Hypopharyngeal gland | 12.2 | 87.8 | 0.13895217 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.4 | 38.3 | 38.1 | 0.92913383 | 1.0052494 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDNRSISKKRKFVGDGVFKAELNEFLTRELSEDGYSGVEVRVTPHRTEIILLATHTQSVL GEKGRRIRELTSVVQKRFNFKETQNIELYAEKVATRGLCAIAQAESLRFKLIGGLAVRRA CYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGEPTNEYVNTATRHVLLR QGVLGIKVKIMLPYDPHGKTGPKKPLPDSVSIVEPKDEVFPSQPTSEVKASKDLPQPIPL AV |
 Top
| |