| Protein: 328784268 XP_003250423.1 PREDICTED: sodium/potassium-transporting ATPase subunit alpha-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 29.8 | 25.9 | 44.3 | 0.6726862 | 0.5846501 |
| Scape | 24.5 | 36.1 | 39.4 | 0.6218274 | 0.9162437 |
| Brain | 34.5 | 20.3 | 45.2 | 0.7632743 | 0.44911504 |
| Crop | |||||
| Eye | 29.2 | 70.8 | 0.4124294 | ||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | 87.1* | 12.9 | 6.751938 | ||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 79* | 7.6 | 13.3 | 5.93985 | 0.5714286 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 27.8 | 72.2 | 0.38504156 | ||
| Malpighian tubules | |||||
| Nerve chord | 7.3 | 74.3 | 18.5 | 0.3945946 | 4.0162163 |
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | 68.4 | 31.6 | 2.164557 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 40.6 | 38.5 | 38.7 | 1.0490956 | 0.99483204 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MHNLNFCKYNFVNMHTCTYIYIFFSILLSCVRCTGWLVHVFFLINGGWQVPAISLAYEAP ESDIMKRQPRDPYRDNLVNRRLISMAYGQIGMIQAAAGFFVYFVIMAENGFLPLHLFGIR KQWDSKAINDLRDSYGQEWTYRDRKTLEFTCHTAFFVSIVIVQWADLIVCKTRRNSIIHQ GMRNWALNFGLIFETALAAFLSYTPGMDKGLRMFPLKFVWWLPALPFMFAIFIYDETRRF YLRRNPGGWLEQETYY |
 Top
| |