| Protein: 110767298 XP_001120360.1 PREDICTED: 60S ribosomal protein L21 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 44.1 | 55.9 | 0.7889088 | ||
| Scape | 48.7 | 23 | 28.4 | 1.7147887 | 0.80985916 |
| Brain | |||||
| Crop | 50.3 | 49.7 | 1.0120724 | ||
| Eye | 3.6 | 55.4 | 41 | 0.087804876 | 1.3512195 |
| Intestine | 17.4 | 46.4 | 36.2 | 0.48066297 | 1.281768 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 82.2 | 17.8 | 4.6179776 | ||
| Salivary gland, thoracic | 30.4 | 27.2 | 42.5 | 0.7152941 | 0.64 |
| Sternite | 25.2 | 40.4 | 34.3 | 0.7346939 | 1.1778426 |
| Tergite | 22.5 | 75.8* | 1.7 | 13.235294 | 44.588234 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 38.7 | 31.5 | 29.8 | 1.2986578 | 1.057047 |
| Malpighian tubules | 34.9 | 25.9 | 39.2 | 0.8903061 | 0.66071427 |
| Nerve chord | 44.7 | 12.5 | 42.8 | 1.0443925 | 0.29205608 |
| Poison sac | |||||
| Sting | 25.5 | 74.5 | 0.34228188 | ||
| Heart | 22.3 | 48.8 | 28.8 | 0.7743056 | 1.6944444 |
| Hypopharyngeal gland | 14.7 | 85.3 | 0.17233294 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.7 | 37.2 | 40.5 | 0.8320988 | 0.91851854 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTNSKGYRRGTRDLFSRKFRKHGTIPLSTYMKVYKVGDIVDIKGNGAVQKGMPYKVYHGK TGRVFNVTPHALGVIVNKRVRGRIIAKRINVRIEHLTHSKCREDFLKRVKENERLRKEAK EKNIKVQLKRQPAEPMPAHIVSGRENPISLAPIPYEFIA |
 Top
| |