| Protein: 66509908 XP_624084.1 PREDICTED: 40S ribosomal protein S5 isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 41.4 | 58.6 | 0.7064846 | ||
| Scape | 38 | 25.8 | 36.3 | 1.046832 | 0.7107438 |
| Brain | |||||
| Crop | 22.6 | 44.6 | 32.8 | 0.6890244 | 1.3597561 |
| Eye | 66.4 | 33.6 | 1.9761904 | ||
| Intestine | 8.7 | 54.1 | 37.2 | 0.23387097 | 1.4543011 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 19.4 | 45.2 | 35.3 | 0.5495751 | 1.2804532 |
| Sternite | 41.5 | 40.8 | 17.7 | 2.3446329 | 2.3050847 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 3* | 97 | 0.030927835 | ||
| Fat body | 26.9 | 38.4 | 34.7 | 0.77521616 | 1.1066283 |
| Malpighian tubules | 44.6 | 20.1 | 35.3 | 1.2634561 | 0.5694051 |
| Nerve chord | 42.5 | 57.5 | 0.73913044 | ||
| Poison sac | |||||
| Sting | 30.2 | 69.8 | 0.43266475 | ||
| Heart | 2.8 | 71.1 | 26.1 | 0.1072797 | 2.724138 |
| Hypopharyngeal gland | 26.9 | 73.1 | 0.36798906 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 27.5 | 39.1 | 46.1 | 0.5965293 | 0.84815615 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAEMETYDDIVVPTTTTLPVALSAELPEIKLFGRWNCDDVQVNDMSLQDYIAVKEKNAKY LPHSAGRYAAKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGDNP LQVLVTAIINSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKT IAECLADELINAAKGSSNSYAIKKKDELERVAKSNR |
 Top
| |