| Protein: 328783290 XP_625223.2 PREDICTED: complexin |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 42.6 | 23.2 | 34.2 | 1.245614 | 0.67836255 |
| Brain | 10.2* | 89.8 | 0.11358575 | ||
| Crop | |||||
| Eye | 56.9 | 43.1 | 1.3201857 | ||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 93.8* | 0.8* | 5.4 | 17.37037 | 0.14814815 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | 30 | 18.4 | 51.5 | 0.5825243 | 0.35728157 |
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 55.8 | 13.2 | 44.8 | 1.2455357 | 0.29464287 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAAFVAKQMVGNKLNAVKGAVGGEGGDEDDKEKEEEAERERQEAIREAEERRKEKHRKME EEREKMRQEIRDKYNIKKREEVQEMTQEEPNPLMRKKKTPEELAAEAEAEEEDEITKIKN ALDTHIQEIKAQVLDGKCDLQ |
 Top
| |