| Protein: 328777158 XP_001120585.2 PREDICTED: endocuticle structural glycoprotein SgAbd-8 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 25.1 | 33.2 | 41.7 | 0.60191846 | 0.7961631 |
| Scape | 49.5 | 14.1 | 36.4 | 1.3598901 | 0.38736263 |
| Brain | |||||
| Crop | 58.7 | 1* | 40.3 | 1.4565756 | 0.024813896 |
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | 64.1 | 35.9 | 1.7855153 | ||
| Leg, rear | |||||
| Mandibular gland | 33.3 | 22.6 | 44.1 | 0.75510204 | 0.5124717 |
| Rectum | 25.1 | 50.4 | 24.5 | 1.0244898 | 2.057143 |
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 97.7* | 2.3 | 42.47826 | ||
| Sternite | 23.9 | 30.8 | 45.3 | 0.5275938 | 0.6799117 |
| Tergite | 13.8 | 17 | 69.2 | 0.19942197 | 0.24566475 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 93 | 7 | 13.285714 | ||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | 0.1* | 99.9 | 0.001001001 | ||
| Sting | 8.5* | 91.5 | 0.09289618 | ||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | 25.4 | 33.3 | 41.3 | 0.6150121 | 0.8062954 |
| Glossa | 29.1 | 36.8 | 34.1 | 0.85337245 | 1.0791789 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 40.1 | 28.8 | 43.8 | 0.91552514 | 0.65753424 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MRIQSQGDGDASLWCTVAIVTWPNGRIGDASRGIYTTSAAGLDKHLPISDYCCSMYTSLI AVIALAGCVAAAPAEDVIPIVAQSQEGPNPDGSYKWSYESGNGIKAQEEGHLENAGQENE AMNAQGSFSYPSDDGQQISLTYIANEEGFQPQGAHLPTTPEIPPLIQKALDWIAAHPSKE DQNQV |
 Top
| |