| Protein: 94400899 NP_001035346.1 troponin I |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 44.9 | 55.1 | 0.81488204 | ||
| Scape | 45.8* | 35.9 | 18.3 | 2.5027323 | 1.9617486 |
| Brain | |||||
| Crop | 37.4 | 7.8* | 54.9 | 0.6812386 | 0.1420765 |
| Eye | 37.9 | 62.1 | 0.61030596 | ||
| Intestine | 58.4* | 20.7 | 20.9 | 2.7942584 | 0.9904306 |
| Leg, front | 31.9 | 34 | 34.1 | 0.9354839 | 0.99706745 |
| Leg, middle | 13.7* | 48 | 38.4 | 0.35677084 | 1.25 |
| Leg, rear | 51.2 | 24.2 | 24.6 | 2.0813007 | 0.98373985 |
| Mandibular gland | 27.9 | 4.1 | 68 | 0.41029412 | 0.060294118 |
| Rectum | 57.5 | 5.1 | 37.4 | 1.5374331 | 0.13636364 |
| Salivary gland, cerebral | 1* | 75.6 | 23.5 | 0.04255319 | 3.2170212 |
| Salivary gland, thoracic | 93.9* | 0.6* | 5.4 | 17.38889 | 0.11111111 |
| Sternite | 30.7 | 23.9 | 45.4 | 0.6762115 | 0.52643174 |
| Tergite | 42.6 | 24 | 33.4 | 1.2754492 | 0.7185629 |
| Ventriculus | |||||
| Thoracic muscle | 62.2 | 37.8 | 1.6455027 | ||
| Fat body | 91.3* | 6.3 | 2.4 | 38.041668 | 2.625 |
| Malpighian tubules | 58.4 | 3.2* | 38.4 | 1.5208334 | 0.083333336 |
| Nerve chord | 90* | 2.8 | 7.2 | 12.5 | 0.3888889 |
| Poison sac | |||||
| Sting | 52.6 | 47.4 | 1.1097046 | ||
| Heart | 39.5 | 32.1 | 28.5 | 1.3859649 | 1.1263158 |
| Hypopharyngeal gland | 99.3* | 0.7 | 141.85715 | ||
| Galea | 26.5 | 50.4 | 23.1 | 1.1471862 | 2.1818182 |
| Glossa | 29.1 | 28.1 | 42.8 | 0.67990655 | 0.65654206 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 46.8 | 30.1 | 32.6 | 1.4355829 | 0.9233129 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MADDERKRLEDEKKRKQAETDRKRAEVRARLEEASKAKKAKKGFMTPDRKKKLRLLLRKK AAEELKKEQERKAAERRRIIEERCGKPKNVDDASEESLKRVLREYHNRITALEDQKFDLE YVVKKKDYEIADLNSQVNDLRGKFMKPTLKKVSKYENKFAKLQKKAAEFNFRNQLKQVKK KEFTLEEEDKEKKPDWSKKGEEKKVKEEEVEA |
 Top
| |