![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 66523029 XP_623353.1 PREDICTED: carbohydrate kinase domain-containing protein-like isoform 1 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 20.1 | 79.9 | 0.25156444 | ||
| Brain | |||||
| Crop | 4.3* | 47.2 | 48.4 | 0.08884297 | 0.9752066 |
| Eye | |||||
| Intestine | 69.7 | 30.3 | 2.30033 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 59.9 | 40.1 | 1.4937656 | ||
| Salivary gland, thoracic | 11 | 61.9 | 27.1 | 0.40590405 | 2.284133 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 27.5 | 31.2 | 41.4 | 0.6642512 | 0.7536232 |
| Malpighian tubules | 25.5 | 52 | 22.6 | 1.1283185 | 2.300885 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 2.7 | 56 | 41.3 | 0.065375306 | 1.3559322 |
| Hypopharyngeal gland | 74.2 | 25.8 | 2.875969 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 21.8 | 51.5 | 39.6 | 0.55050504 | 1.300505 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSTTVSNDERMLKGIRRVIPNLNNTKYKGQDGRIGIFGGSLEYTGAPYYAAMSALRTGCD LVHIFCVKDASFPLKAFSPEPIVHPVLDQYDAIKQIRPWLDRLHIIIIGPGLGRDDKVFK IIVELISICRDMKKPLVIDADGLFLISQKPDIIKEYPGAVLTPNAMEFSRLVKGVLDKNV QPTPMVKANDVKHLADALGKNVIVLHKGAKDVIADGHKGTEAVSCGLAGSGRRCGGQGDL LCGALAVFWWWAICAGNNESALSPPIAASYAASRLVRECNSSAYKLKQRGMLTTDILEQI QPVFARIFETHFNKTSSFNGRNRTRSIDS |
|
| |