| Protein: 66522467 XP_623685.1 PREDICTED: hypothetical protein LOC408421 isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 45.7 | 16.3 | 38 | 1.2026316 | 0.42894736 |
| Scape | 46.1 | 25 | 28.9 | 1.5951557 | 0.8650519 |
| Brain | 16.4 | 37.5 | 46.1 | 0.3557484 | 0.813449 |
| Crop | 35.4 | 21.7 | 42.9 | 0.8251748 | 0.5058275 |
| Eye | |||||
| Intestine | 57.8* | 25.5 | 16.7 | 3.461078 | 1.5269461 |
| Leg, front | 47.5 | 11.6* | 40.9 | 1.1613692 | 0.28361857 |
| Leg, middle | 47.9 | 10* | 42.1 | 1.1377672 | 0.2375297 |
| Leg, rear | 37 | 16.7 | 46.2 | 0.8008658 | 0.36147186 |
| Mandibular gland | 87.5* | 12.5 | 7 | ||
| Rectum | 76.3 | 23.7 | 3.2194092 | ||
| Salivary gland, cerebral | 30.7 | 69.3 | 0.44300145 | ||
| Salivary gland, thoracic | 34.3 | 27.2 | 38.5 | 0.8909091 | 0.7064935 |
| Sternite | |||||
| Tergite | 67.7 | 32.3 | 2.0959752 | ||
| Ventriculus | 3.3 | 42 | 54.6 | 0.06043956 | 0.7692308 |
| Thoracic muscle | |||||
| Fat body | 69 | 8.8 | 22.2 | 3.108108 | 0.3963964 |
| Malpighian tubules | 39.1 | 36.8 | 24.1 | 1.6224066 | 1.526971 |
| Nerve chord | 24.3 | 55.9 | 19.9 | 1.2211056 | 2.8090453 |
| Poison sac | |||||
| Sting | 29.2 | 70.8 | 0.4124294 | ||
| Heart | 17.5 | 26.1 | 56.3 | 0.31083483 | 0.4635879 |
| Hypopharyngeal gland | |||||
| Galea | 56.2 | 8.8 | 35 | 1.6057143 | 0.25142857 |
| Glossa | 63.6 | 10.6 | 25.8 | 2.4651163 | 0.4108527 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 43.5 | 27 | 37.5 | 1.16 | 0.72 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVDKLEWLNNEFVQRVLQYNEYDTSINVTNISAKPATSKGDNYASDMYRVTVKYTQKEGK TRVNKETSIVCKFEPLEEDARREAIMSMGIFENEIFMMSNSLRKMQQMLGTRLGANVLYF RMERPVCLILEDLARLGFRMADRFRGLDFDHSKLTLQSLGKFHAASVALCEKEPKLKTVY QKGILYEGMPTEFKFFFISAIKALGDDLANWPQDVKRYQDKVKKFAEVVYDRGIAALQRN DDEFNVINHGDSWTNNMMYRYDENSKPVQHVFVDYQMSIYTSPAIDLLYFLNATVQNEVN TENLIEEYVNTLTSTMKRLGCKTAPPTVKDIKRYMRERIAWGMVAAATVLPFTLMDKSQV VSIDELIKKRDTFDYPGTKNPMYRKVMAERLAKFEEAGVFD |
 Top
| |