| Protein: 110767655 XP_624951.2 PREDICTED: eukaryotic translation initiation factor 5A-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 41.9 | 21.2 | 36.9 | 1.1355014 | 0.5745258 |
| Scape | 45.5 | 24.2 | 30.3 | 1.5016502 | 0.7986799 |
| Brain | 39.1 | 60.9 | 0.64203614 | ||
| Crop | 36.4 | 25.1 | 38.5 | 0.94545454 | 0.65194803 |
| Eye | |||||
| Intestine | 30.7 | 32.5 | 36.7 | 0.83651227 | 0.8855586 |
| Leg, front | 57.4 | 42.6 | 1.3474178 | ||
| Leg, middle | 56.1 | 43.9 | 1.2779043 | ||
| Leg, rear | 36.9 | 24.7 | 38.4 | 0.9609375 | 0.6432292 |
| Mandibular gland | 16 | 84 | 0.1904762 | ||
| Rectum | |||||
| Salivary gland, cerebral | 49.6 | 10.9 | 39.5 | 1.2556962 | 0.27594936 |
| Salivary gland, thoracic | 52.9 | 13.1 | 34 | 1.5558823 | 0.3852941 |
| Sternite | 62.7 | 21.9 | 15.3 | 4.098039 | 1.4313725 |
| Tergite | 47.9 | 42.3 | 9.8 | 4.887755 | 4.3163266 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 29.7 | 32.7 | 37.6 | 0.7898936 | 0.8696808 |
| Malpighian tubules | 28.9 | 39.2 | 31.9 | 0.9059561 | 1.2288401 |
| Nerve chord | 41.7 | 28.2 | 30.1 | 1.385382 | 0.9368771 |
| Poison sac | |||||
| Sting | |||||
| Heart | 22.6 | 38 | 39.4 | 0.57360405 | 0.964467 |
| Hypopharyngeal gland | 21.9 | 78.1 | 0.28040972 | ||
| Galea | |||||
| Glossa | 24.2 | 75.8 | 0.31926122 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 40.1 | 27.7 | 42.3 | 0.94799054 | 0.6548463 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MADIEDTHFETGDSGASVTYPMQCSALRKNGFVMLKSRPCKIVEMSTSKTGKHGHAKVHL VGIDIFTSKKYEDICPSTHNMDVPFVKREDYQLADISDDGYLCLMADNGELREDLKIPDG ELGAQLRADHEAGKELLCTVLKACGEEVVIAIKTNTAIDK |
 Top
| |