| Protein: 66504546 XP_394333.2 PREDICTED: protein lethal(2)essential for life-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 72.7* | 27.3 | 2.6630037 | ||
| Scape | 33.3 | 40.6 | 26.2 | 1.2709924 | 1.5496184 |
| Brain | |||||
| Crop | 38.5 | 19.8 | 41.8 | 0.92105263 | 0.47368422 |
| Eye | |||||
| Intestine | 32.5 | 40 | 27.5 | 1.1818181 | 1.4545455 |
| Leg, front | 21.4* | 19.6* | 59 | 0.36271188 | 0.3322034 |
| Leg, middle | 28.3 | 11.6* | 60.1 | 0.47088185 | 0.19301164 |
| Leg, rear | 44.6 | 11* | 44.4 | 1.0045046 | 0.24774775 |
| Mandibular gland | 87.5* | 12.5 | 7 | ||
| Rectum | 55.7 | 44.3 | 1.2573364 | ||
| Salivary gland, cerebral | 13.9 | 37.6 | 48.5 | 0.28659794 | 0.7752577 |
| Salivary gland, thoracic | 44.7 | 32.6 | 22.6 | 1.9778761 | 1.4424778 |
| Sternite | 68.5 | 16 | 15.6 | 4.3910255 | 1.0256411 |
| Tergite | 86.9 | 4 | 9.1 | 9.549451 | 0.43956044 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 82.5* | 12.7 | 4.8 | 17.1875 | 2.6458333 |
| Malpighian tubules | 72.6 | 4.5* | 22.8 | 3.1842105 | 0.19736843 |
| Nerve chord | 4.9* | 13.5* | 81.6 | 0.06004902 | 0.16544117 |
| Poison sac | |||||
| Sting | 42.6 | 57.4 | 0.74216026 | ||
| Heart | 55.3 | 15.3 | 29.4 | 1.8809524 | 0.52040815 |
| Hypopharyngeal gland | |||||
| Galea | 23.5 | 31 | 45.5 | 0.51648355 | 0.6813187 |
| Glossa | 43.2 | 24.8 | 32 | 1.35 | 0.775 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 46.5 | 25 | 35.6 | 1.3061798 | 0.7022472 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSVVPLIFRDWWDDFERPVSRLMDQHFGRGLNRDDLLSRFSDINFDRPLRSIFRDRYYRP WRNVTGQPSSGSSTIQLDNKDNFQVILDVQQFSPEEITVKTVGNNVIVEAKHEERQDEHG FVSRQFIRRYVLPPSHDVINITSSLSSDGVLTITAPKKGETPSGDERIIQIVKTGEPAGK SIKIETTTEEK |
 Top
| |