| Protein: 328783818 XP_003250346.1 PREDICTED: hypothetical protein LOC725312 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 55.4 | 21.7 | 22.9 | 2.419214 | 0.9475983 |
| Scape | 44.1 | 28.4 | 27.5 | 1.6036364 | 1.0327272 |
| Brain | 54.1 | 45.9 | 1.1786492 | ||
| Crop | 37.9 | 36.6 | 25.5 | 1.4862745 | 1.4352942 |
| Eye | |||||
| Intestine | 25.3 | 49.6 | 25.1 | 1.0079681 | 1.9760957 |
| Leg, front | 43.3 | 56.7 | 0.7636684 | ||
| Leg, middle | 74.5* | 25.5 | 2.9215686 | ||
| Leg, rear | 48.2 | 51.8 | 0.93050194 | ||
| Mandibular gland | 24.1 | 51 | 25 | 0.964 | 2.04 |
| Rectum | 48.2 | 51.8 | 0.93050194 | ||
| Salivary gland, cerebral | 63.7 | 36.3 | 1.754821 | ||
| Salivary gland, thoracic | 48 | 20.8 | 31.1 | 1.5434084 | 0.6688103 |
| Sternite | 52.9 | 34.6 | 12.5 | 4.232 | 2.768 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 92.6* | 3.6 | 3.8 | 24.368422 | 0.94736844 |
| Malpighian tubules | 29.7 | 50.6 | 19.7 | 1.5076143 | 2.568528 |
| Nerve chord | 25.7 | 31.7 | 42.5 | 0.60470587 | 0.74588233 |
| Poison sac | |||||
| Sting | 39.7 | 60.3 | 0.6583748 | ||
| Heart | 35.2 | 47.9 | 16.8 | 2.0952382 | 2.8511906 |
| Hypopharyngeal gland | 6 | 94 | 0.06382979 | ||
| Galea | 52.3 | 47.7 | 1.096436 | ||
| Glossa | 8.2* | 46.1 | 45.7 | 0.17943107 | 1.0087527 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 44.4 | 37 | 36.6 | 1.2131147 | 1.010929 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAFIKKEFDKKYNPTWHCIVGR NFGSYVTHETRHFIYFYLGQVAILLFKSG |
 Top
| |