| Protein: 328782950 XP_001120412.2 PREDICTED: putative succinate dehydrogenase [ubiquinone] cytochrome b small subunit mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 29.9 | 36 | 34.2 | 0.874269 | 1.0526316 |
| Scape | 5.7 | 94.3 | 0.060445387 | ||
| Brain | 20.7 | 20 | 59.3 | 0.34907252 | 0.3372681 |
| Crop | 47.9 | 52.1 | 0.9193858 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | 35.3 | 18.4 | 46.3 | 0.762419 | 0.39740822 |
| Leg, middle | 24.6 | 43.7 | 31.7 | 0.77602524 | 1.3785489 |
| Leg, rear | |||||
| Mandibular gland | 6.9 | 93.1 | 0.07411385 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 28.9 | 71.1 | 0.40646976 | ||
| Sternite | 17.4 | 24.3 | 58.2 | 0.29896906 | 0.41752577 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 17.9 | 62.1 | 20 | 0.895 | 3.105 |
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 9.8 | 50.7 | 39.5 | 0.24810126 | 1.2835443 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 23.4 | 32.2 | 54.5 | 0.4293578 | 0.5908257 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MILKSVASPSIFHKVRQLESFSKTTLFANSCKLLQFTRKSSNFAIFKQCLNSSLNKNERQ LLKFPTNTIILNTEITRKTSTTASDHVRMWILEKIASAALPVIIPVALTMENVICDGLMS LLIVIHMHWGLEAIITDYARPRVVGPLLPKLLHLSLIFLSAITLCGLFLLINNGPGVSKA IKEAWAIGKEPPPNDDSNPNE |
 Top
| |