| Protein: 295842263 NP_001171499.1 glutathione S-transferase D1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 69.3* | 8.5* | 22.2 | 3.1216216 | 0.3828829 |
| Scape | 51.1 | 15.3 | 33.6 | 1.5208334 | 0.45535713 |
| Brain | 85.9* | 14.1 | 6.0921984 | ||
| Crop | 8.3 | 72.9* | 18.8 | 0.44148937 | 3.8776596 |
| Eye | |||||
| Intestine | 15.6 | 57.6 | 26.8 | 0.58208954 | 2.1492538 |
| Leg, front | 20.6* | 13.1* | 66.3 | 0.3107089 | 0.19758673 |
| Leg, middle | 13.2* | 13.2* | 73.6 | 0.17934783 | 0.17934783 |
| Leg, rear | 18 | 18.4 | 63.6 | 0.28301886 | 0.2893082 |
| Mandibular gland | 14.6 | 85.4 | 0.17096019 | ||
| Rectum | 11.7 | 38.5 | 49.8 | 0.23493975 | 0.7730924 |
| Salivary gland, cerebral | 30.7 | 43.2 | 26.1 | 1.1762452 | 1.6551725 |
| Salivary gland, thoracic | 21.1* | 14 | 64.9 | 0.32511556 | 0.21571648 |
| Sternite | 2.5* | 29.9 | 67.6 | 0.03698225 | 0.44230768 |
| Tergite | 3.4 | 47.7 | 48.8 | 0.06967213 | 0.977459 |
| Ventriculus | 57.3 | 9.1 | 33.5 | 1.7104478 | 0.2716418 |
| Thoracic muscle | |||||
| Fat body | 18.2 | 29.3 | 52.5 | 0.34666666 | 0.5580952 |
| Malpighian tubules | 32.4 | 35.7 | 31.9 | 1.015674 | 1.1191223 |
| Nerve chord | 71.8 | 28.2 | 2.5460992 | ||
| Poison sac | |||||
| Sting | 33.5 | 66.5 | 0.5037594 | ||
| Heart | 3* | 36.4 | 60.5 | 0.049586777 | 0.6016529 |
| Hypopharyngeal gland | |||||
| Galea | 8.8 | 59.1 | 32.1 | 0.2741433 | 1.8411216 |
| Glossa | 38.7 | 15.4 | 45.9 | 0.84313726 | 0.33551198 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 23.1 | 35.6 | 46 | 0.5021739 | 0.773913 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MPIDFYQLPGSPPCRAVALTAAALDIEMNFKQVNLMNGEHLKPEFLKINPQHTIPTIDDN GFRLWESRAIMTYLADQYGKNDTLYPKDLKKRAIVNQRLYFDMCSLYKSFMDYYYPIIFM KAVKDQAKYENIGTALSFLDKFLEGENYVAGKNMTLADLSIVSTVSTLEALDYDLSKYKN VTRWFAKIKPEIPKYEEYNNAGLKMFKELVNEKLSKK |
 Top
| |