| Protein: 328782596 XP_395766.4 PREDICTED: succinate-semialdehyde dehydrogenase mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 22 | 37.3 | 40.7 | 0.5405405 | 0.91646194 |
| Scape | 22.9 | 41.4 | 35.7 | 0.6414566 | 1.1596639 |
| Brain | 56.4 | 43.6 | 1.293578 | ||
| Crop | 25 | 40.4 | 34.6 | 0.72254336 | 1.1676301 |
| Eye | |||||
| Intestine | 45.9 | 26.8 | 27.3 | 1.6813186 | 0.981685 |
| Leg, front | 27.8 | 41.9 | 30.4 | 0.9144737 | 1.3782895 |
| Leg, middle | 32.3 | 37.8 | 29.9 | 1.0802675 | 1.264214 |
| Leg, rear | 36 | 41.1 | 22.9 | 1.5720524 | 1.7947599 |
| Mandibular gland | 46 | 54 | 0.8518519 | ||
| Rectum | |||||
| Salivary gland, cerebral | 61.4 | 7.9 | 30.7 | 2 | 0.257329 |
| Salivary gland, thoracic | 28.8 | 40 | 31.2 | 0.9230769 | 1.2820513 |
| Sternite | 82.6 | 17.4 | 4.7471266 | ||
| Tergite | 86.5 | 13.5 | 6.4074073 | ||
| Ventriculus | |||||
| Thoracic muscle | 15.6 | 51.6 | 32.8 | 0.47560975 | 1.5731708 |
| Fat body | 41.1 | 40.9 | 18 | 2.2833333 | 2.2722223 |
| Malpighian tubules | 33.4 | 34.4 | 32.3 | 1.0340557 | 1.0650154 |
| Nerve chord | 29.8 | 39.9 | 30.2 | 0.98675495 | 1.321192 |
| Poison sac | |||||
| Sting | 44.1 | 55.9 | 0.7889088 | ||
| Heart | 31.5 | 35.5 | 33 | 0.95454544 | 1.0757576 |
| Hypopharyngeal gland | 80.3 | 19.7 | 4.0761423 | ||
| Galea | 35.2 | 22.8 | 42 | 0.83809525 | 0.54285717 |
| Glossa | 20.3 | 49.8 | 30 | 0.6766667 | 1.66 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.6 | 44.7 | 32.1 | 1.0155764 | 1.3925234 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MHILQRNILHYIPSLNRSMHLLKDLAYINGKWVSAIKQQTFPVYNPIDKSIIKNVPDMDV EDTKLAINSAFEAFKSFKKTTAKERSNLLRNWYNLIVKHSEDLAKILTKENGKSIAESKD EIRYGNSYIEWFSEEARRIEGEILQAPISNRNLLLWKEPIGVAALITPWNFPFAMITRKA AAALAVGCTCIIKPSEDTPLIALALVELAEKAGFPQGTINVITTSQKNSPIVGKELCENS NTRVLSFTGSTNVGKILYQQCASNVKRLCLELGGNASFIVFDSADIDLAIKGAMASKFRN CGQTCVSANRFFVQNSKFDQFVEMLLSKIKTEIRMGDGSKKDTTHGPLTKKSQLDLIHAL VTDAVKKGAKLHCGGTPLPELGPLFYAPTLITGVTKEMEIYNREIFGPVAVIYKFDTEDE VIQKSNNVSVGLAGYFYSQDLSQIFRVAKQLEVGMIGVNEGLISTAEAAFGGIKESGLGR EGSKHGIEDFLEIKYVCIGNLKY |
 Top
| |