| Protein: 48094929 XP_392209.1 PREDICTED: programmed cell death protein 6-like isoform 3 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 58.2 | 41.8 | 1.3923445 | ||
| Scape | 33.8 | 30.1 | 36.1 | 0.9362881 | 0.833795 |
| Brain | |||||
| Crop | 39.9 | 29.6 | 30.5 | 1.3081967 | 0.9704918 |
| Eye | |||||
| Intestine | 61.3 | 38.7 | 1.5839794 | ||
| Leg, front | 23.9 | 46 | 30.2 | 0.7913907 | 1.5231788 |
| Leg, middle | 39.6 | 31.9 | 28.6 | 1.3846154 | 1.1153846 |
| Leg, rear | 65.1 | 34.9 | 1.8653295 | ||
| Mandibular gland | 15.7 | 84.3 | 0.18623962 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 26.1 | 40.9 | 33.1 | 0.7885196 | 1.2356496 |
| Sternite | 27.1 | 32.9 | 40 | 0.6775 | 0.8225 |
| Tergite | 64.1 | 35.9 | 1.7855153 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 54.6 | 22.2 | 23.2 | 2.3534484 | 0.95689654 |
| Malpighian tubules | 29.9 | 41.1 | 29 | 1.0310345 | 1.4172413 |
| Nerve chord | 27.2 | 58.5 | 14.3 | 1.902098 | 4.090909 |
| Poison sac | |||||
| Sting | 59 | 41 | 1.4390244 | ||
| Heart | 31.3 | 34.5 | 34.2 | 0.9152047 | 1.0087719 |
| Hypopharyngeal gland | 87 | 13 | 6.6923075 | ||
| Galea | 62.5 | 37.5 | 1.6666666 | ||
| Glossa | 38.5 | 36.7 | 24.8 | 1.5524193 | 1.4798387 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.3 | 44.9 | 34.3 | 1.116618 | 1.3090379 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSFVSPMPSREFLWDVFQRVDRDRSGAITADELQQALSNGTWTPFNPETVRLMIGMFDKN QKGTVSFEEFGALWKYVTDWQNCFRSFDRDNSGNIDRNELKTALTNFGYRLSDQIIDTLI RKYDRAGRGTIYFDDFIQCCVVLYTLTAAFRQLDTDLDGVITIHYEQFLGMVFNLKI |
 Top
| |