| Protein: 328790570 XP_003251432.1 PREDICTED: TRAF-interacting protein-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 1.2* | 98.8 | 0.012145749 | ||
| Scape | 0.9* | 2.7* | 96.4 | 0.0093361 | 0.028008299 |
| Brain | |||||
| Crop | 3.8* | 96.2 | 0.03950104 | ||
| Eye | |||||
| Intestine | 5* | 95 | 0.05263158 | ||
| Leg, front | 8.5* | 91.5 | 0.09289618 | ||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 1.8* | 98.2 | 0.018329939 | ||
| Rectum | 1.2* | 98.8 | 0.012145749 | ||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 99.2* | 0* | 0.8 | 124 | 0 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | 0.6* | 1* | 98.4 | 0.006097561 | 0.010162602 |
| Poison sac | |||||
| Sting | |||||
| Heart | 2.5* | 1.7* | 95.8 | 0.026096033 | 0.017745303 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 16.4 | 2.2 | 87 | 0.18850575 | 0.025287356 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNIICVICSDLLIPSDDVFYTPCGHIFHFACVTQWLERSKTCPHCRERTTLNKIHRIYFN FANSDAISEDTYSLQDKIDKLNFQLMLKEKDIKHYMEKIETLEKQKKGLKQEVGKTEKEI KEKTSTIYALKEQIKYFKEQNLEIEKIKKELEQLQKNVENYKNIKILLEASIEDVDEMIS RTNDPSTLITYISVMKRQMTISLNKRRELRSNLRSLQQELTRVSMERNSLSQEYSKRMKL EEDIMVCETEKICLQNKLAKMEEEISSIKKSINSNSKTEDILINNSNNDIKQDKIENINN KTKSKEEDINSKEKNQSITKIEIDSPYLPVKSRGVFTLKQHTAFQKNSTIKLNSSILTKK PRIQETYTKNCMLKMCKKNGKSVEQLNS |
 Top
| |