| Protein: 66520256 XP_393789.2 PREDICTED: electron transfer flavoprotein subunit beta-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 21.5 | 40 | 38.5 | 0.5584416 | 1.038961 |
| Scape | 25.9 | 37 | 37.1 | 0.6981132 | 0.99730456 |
| Brain | 84.8* | 15.2 | 5.5789475 | ||
| Crop | 19.4 | 40.5 | 40.1 | 0.48379052 | 1.0099751 |
| Eye | |||||
| Intestine | 34.8 | 30.5 | 34.7 | 1.0028819 | 0.8789625 |
| Leg, front | 29.1 | 44.1 | 26.8 | 1.0858209 | 1.6455224 |
| Leg, middle | 31 | 44.3 | 24.7 | 1.2550607 | 1.7935222 |
| Leg, rear | 54.6 | 29.6 | 15.7 | 3.477707 | 1.8853503 |
| Mandibular gland | 21.3 | 59.2 | 19.5 | 1.0923077 | 3.0358975 |
| Rectum | 28 | 72 | 0.3888889 | ||
| Salivary gland, cerebral | 96.5* | 0.7 | 2.8 | 34.464287 | 0.25 |
| Salivary gland, thoracic | 13.7* | 55 | 31.3 | 0.43769968 | 1.7571884 |
| Sternite | 29.5 | 42.9 | 27.6 | 1.0688406 | 1.5543479 |
| Tergite | 10.5 | 63.3 | 26.2 | 0.40076336 | 2.4160306 |
| Ventriculus | 9.3 | 51.8 | 38.9 | 0.23907454 | 1.3316195 |
| Thoracic muscle | 2.5 | 82.1 | 15.4 | 0.16233766 | 5.3311687 |
| Fat body | 12.1 | 54 | 33.9 | 0.35693216 | 1.5929203 |
| Malpighian tubules | 30 | 38.4 | 31.6 | 0.9493671 | 1.2151898 |
| Nerve chord | 27.1 | 49.1 | 23.8 | 1.1386554 | 2.0630252 |
| Poison sac | |||||
| Sting | 60.1 | 39.9 | 1.5062656 | ||
| Heart | 18.1 | 50.2 | 31.7 | 0.5709779 | 1.5835962 |
| Hypopharyngeal gland | 86.2 | 13.8 | 6.246377 | ||
| Galea | 39.6 | 31.3 | 29 | 1.3655173 | 1.0793103 |
| Glossa | 34.9 | 29.8 | 35.3 | 0.98866856 | 0.8441926 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 28.1 | 48 | 29.4 | 0.9557823 | 1.6326531 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MARALVGVKRVIDYAVKIRVKSDKTGVVTDGVKHAMNPFDEIAIEEAIRMKEKKLVQEII AVSCGPPQCQDVIRTALAMGADKGIHVEISGSEYETLQPIHVSKLIAKLAQEEKADLIIV GKQAIDDDSNQTAQMIGGILDWPTGTFCSKIEKNNDDLTVTREVDGGLEVVKIKMPTVLS ADLRLNEPRYATLPNIMKAKKKPIKKVTAKDLGVDTTARIEILSVEEPPVRQAGSIVPDV DTLIAKLKESGHI |
 Top
| |