| Protein: 74271822 NP_001011604.2 40S ribosomal protein S8 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 44.6 | 55.4 | 0.8050541 | ||
| Scape | 43.2 | 30.9 | 25.8 | 1.6744186 | 1.1976744 |
| Brain | |||||
| Crop | 30.1 | 37.5 | 32.4 | 0.92901236 | 1.1574074 |
| Eye | 7 | 57.6 | 35.4 | 0.19774011 | 1.6271186 |
| Intestine | 25.6 | 42.3 | 32.1 | 0.79750776 | 1.317757 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 94.3 | 0.4 | 5.3 | 17.792454 | 0.0754717 |
| Salivary gland, thoracic | 29.7 | 34.6 | 35.7 | 0.8319328 | 0.9691877 |
| Sternite | 83.8 | 16.2 | 5.1728396 | ||
| Tergite | 17.9 | 76.2* | 5.9 | 3.0338984 | 12.915255 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 30.8 | 32.6 | 36.6 | 0.8415301 | 0.89071035 |
| Malpighian tubules | 34.9 | 26.5 | 38.6 | 0.90414506 | 0.6865285 |
| Nerve chord | 40.6 | 16.8 | 42.6 | 0.9530516 | 0.3943662 |
| Poison sac | |||||
| Sting | 52.5 | 47.5 | 1.1052631 | ||
| Heart | 21.8 | 49 | 29.2 | 0.74657536 | 1.6780822 |
| Hypopharyngeal gland | 19.9 | 80.1 | 0.24843945 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.3 | 37.3 | 34.6 | 1.1069365 | 1.0780346 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGISRDHWHKRRATGGKRKPIRKKRKFELGRPAANTKLGPQRIHTVRTRGGNKKYRALRL DTGNFSWGSECTTRKTRIIDVVYNASNNELVRTKTLVKNAIVTIDATPFRQWYEGHYVLP LGRKRGAKLTEAEEEVLNKKRSKKAEAKYKARQRFAKVEPALEEQFATGRVLACISSRPG QCGREDGYILEGKELEFYMRRIKSKKAK |
 Top
| |