| Protein: 328776219 XP_624645.2 PREDICTED: 40S ribosomal protein S12 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 64* | 36 | 1.7777778 | ||
| Scape | 46.5* | 36 | 17.5 | 2.6571429 | 2.057143 |
| Brain | |||||
| Crop | 20.1 | 45.2 | 34.7 | 0.5792507 | 1.3025937 |
| Eye | |||||
| Intestine | 61.3 | 38.7 | 1.5839794 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 74.4 | 25.6 | 2.90625 | ||
| Salivary gland, thoracic | 36.1 | 25.4 | 38.4 | 0.9401042 | 0.6614583 |
| Sternite | 22.9 | 42.4 | 34.7 | 0.6599424 | 1.221902 |
| Tergite | 35.2 | 56.4 | 8.4 | 4.1904764 | 6.714286 |
| Ventriculus | 27.4 | 14.1 | 58.5 | 0.46837607 | 0.24102564 |
| Thoracic muscle | |||||
| Fat body | 35.9 | 43.4 | 20.7 | 1.7342995 | 2.0966184 |
| Malpighian tubules | 38.4 | 26.9 | 34.6 | 1.1098266 | 0.77745664 |
| Nerve chord | 45.2 | 14.4 | 40.5 | 1.1160494 | 0.35555556 |
| Poison sac | |||||
| Sting | 47.8 | 52.2 | 0.91570884 | ||
| Heart | 28.9 | 41.5 | 29.6 | 0.9763514 | 1.402027 |
| Hypopharyngeal gland | 19.5 | 80.5 | 0.24223602 | ||
| Galea | 93.1* | 6.9 | 13.492754 | ||
| Glossa | 52.4 | 47.6 | 1.1008403 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39.6 | 41.3 | 35.6 | 1.1123595 | 1.1601124 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLMILFAIFSLRHFSFFIRKVLHSLKNMSDVENDDVPSAMAAGGAMDVNTALQEVLKNAL IHDGVVHGLHEAAKALDKRQAMLCILAENCDEPMYKKLVQALCNEHQIPLIRVDNNKKLG EWAGLCKIDSAGKARKVVGCSCVVIKDFGEDTPAKDVVMEYVKQSSVH |
 Top
| |