| Protein: 66525165 XP_392065.2 PREDICTED: upstream activation factor subunit spp27-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 56.4 | 21.3 | 22.3 | 2.5291479 | 0.9551569 |
| Scape | 36.7 | 41.6 | 21.7 | 1.6912442 | 1.9170507 |
| Brain | 31.5 | 68.5 | 0.459854 | ||
| Crop | 54.8 | 21.8 | 23.3 | 2.3519313 | 0.93562233 |
| Eye | |||||
| Intestine | 25 | 45.7 | 29.4 | 0.8503401 | 1.5544218 |
| Leg, front | 74.5 | 25.5 | 2.9215686 | ||
| Leg, middle | 69.5 | 30.5 | 2.2786884 | ||
| Leg, rear | 77.7 | 22.3 | 3.484305 | ||
| Mandibular gland | 11.6 | 88.4 | 0.13122171 | ||
| Rectum | |||||
| Salivary gland, cerebral | 76.5 | 2.8 | 20.7 | 3.6956522 | 0.1352657 |
| Salivary gland, thoracic | 30 | 30.3 | 39.7 | 0.7556675 | 0.7632242 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 34.9 | 39.7 | 25.4 | 1.3740157 | 1.5629921 |
| Malpighian tubules | 13.5 | 64.6 | 21.9 | 0.6164383 | 2.9497716 |
| Nerve chord | 29.7 | 19.8 | 50.4 | 0.58928573 | 0.39285713 |
| Poison sac | |||||
| Sting | 63.9 | 36.1 | 1.7700831 | ||
| Heart | 30 | 38.4 | 31.6 | 0.9493671 | 1.2151898 |
| Hypopharyngeal gland | 35.9 | 64.1 | 0.5600624 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39.7 | 40.1 | 36.6 | 1.0846995 | 1.0956284 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MADISNEELRKEITAILKDADLTTMSAKKVRLQIEGKLDIDLTERKKEVDNLVMECLQEK QDGAKKKKKTASEESEDGEEEEEEGSEEEEEEEEKKPAKRSPAKKQINKRKKGSSDDEES ASDDDASDEEYNPKKPKATPKKNKPGKKGKKKGSDSDSDEDWGKVKKAQGGGAKKGGGGK AKGGYTRAITLSPELAAVVGAEQMARHEVVKKIWSIIKERNLYDPKNKQYALCDDELLKV IGVKRFRTFGMMKYLKNHFVD |
 Top
| |