| Protein: 328784669 XP_003250481.1 PREDICTED: prefoldin subunit 1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 49.8 | 24.8 | 25.4 | 1.9606299 | 0.97637796 |
| Scape | 53.3 | 46.7 | 1.1413276 | ||
| Brain | 47.7 | 52.3 | 0.9120459 | ||
| Crop | |||||
| Eye | |||||
| Intestine | 30.5 | 28.5 | 41.1 | 0.74209243 | 0.69343066 |
| Leg, front | 50.7 | 17.9 | 31.4 | 1.6146497 | 0.5700637 |
| Leg, middle | 56.1 | 17.7 | 26.3 | 2.1330798 | 0.6730038 |
| Leg, rear | |||||
| Mandibular gland | 4.1 | 95.9 | 0.04275287 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 27.5 | 34.8 | 37.8 | 0.72751325 | 0.9206349 |
| Sternite | 81.5 | 18.5 | 4.4054055 | ||
| Tergite | 82.6 | 17.4 | 4.7471266 | ||
| Ventriculus | 25.3 | 74.7 | 0.33868808 | ||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 49.6 | 50.4 | 0.984127 | ||
| Nerve chord | 36 | 23.2 | 40.9 | 0.8801956 | 0.56723714 |
| Poison sac | |||||
| Sting | |||||
| Heart | 66.5 | 33.5 | 1.9850746 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 47.2 | 27.8 | 42.3 | 1.1158392 | 0.6572104 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAREPDEELRKAFSQLHEKMIDTTQKLKLADLQIEKLKRSKQFAELTMKEITSYPENTKA YESVGRMFLLDNMDSIKIGLKKRMKNADEKVKNLENNKTYLQQNLKECENNIREMIQQRQ NKDTSG |
 Top
| |