| Protein: 328777671 XP_003249382.1 PREDICTED: inorganic pyrophosphatase-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 40.7 | 27.6 | 31.7 | 1.2839117 | 0.87066245 |
| Scape | 29.7 | 37.8 | 32.4 | 0.9166667 | 1.1666666 |
| Brain | 53.6 | 46.4 | 1.1551725 | ||
| Crop | 43.9 | 56.1 | 0.7825312 | ||
| Eye | 20.8 | 42.7 | 36.5 | 0.569863 | 1.169863 |
| Intestine | 27.7 | 39.8 | 32.5 | 0.8523077 | 1.2246153 |
| Leg, front | 28.6 | 47.9 | 23.6 | 1.2118644 | 2.029661 |
| Leg, middle | 28.8 | 45 | 26.2 | 1.0992366 | 1.7175573 |
| Leg, rear | 38.2 | 41.2 | 20.6 | 1.8543689 | 2 |
| Mandibular gland | 54.4 | 45.6 | 1.1929824 | ||
| Rectum | 17.6 | 28.9 | 53.5 | 0.32897195 | 0.54018694 |
| Salivary gland, cerebral | 42.5 | 24 | 33.5 | 1.2686567 | 0.7164179 |
| Salivary gland, thoracic | 27.6 | 37.3 | 35 | 0.7885714 | 1.0657142 |
| Sternite | 24.1 | 50.5 | 25.4 | 0.9488189 | 1.988189 |
| Tergite | 77.5 | 22.5 | 3.4444444 | ||
| Ventriculus | 19.9 | 45.6 | 34.6 | 0.5751445 | 1.317919 |
| Thoracic muscle | 83.5 | 16.5 | 5.060606 | ||
| Fat body | 28.6 | 48.9 | 22.5 | 1.2711111 | 2.1733334 |
| Malpighian tubules | 27.3 | 38.3 | 34.3 | 0.79591835 | 1.116618 |
| Nerve chord | 26.4 | 47 | 26.6 | 0.99248123 | 1.7669173 |
| Poison sac | |||||
| Sting | 62.1 | 37.9 | 1.6385224 | ||
| Heart | 24.1 | 50.2 | 25.7 | 0.9377432 | 1.9533074 |
| Hypopharyngeal gland | 68.3 | 31.7 | 2.1545742 | ||
| Galea | 34.8 | 41.2 | 24 | 1.45 | 1.7166667 |
| Glossa | 14.5 | 62.2 | 23.3 | 0.6223176 | 2.669528 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.3 | 47.7 | 31.9 | 0.9184953 | 1.4952978 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTLLTLHVLRCRGLNKLANPLRLTITGSLIKSRSCSVFKKYAKKMSYTTIERGALNSTDY RIYFRNDVGPISPMHDIPLYADESNKILNMVVEIPRWTNAKMEINLKETLNPIKQDVKKG KLRYVANCFPHHGYIWNYGALPQTWENPEVLDEATGCKGDNDPIDVLEIGYKVAKRGEIL KVKVLGCVALIDEGETDWKIIVIDVNDPLAEQMNDVSDIEKHYPGLMKATIEWFKIYKIP DGKPENQFAFNGEAKSRDFALHIVEEVHQHWQNLIKREAPAGGIACTNTTVSGSPFKTTI ETAEEVLEKAAELSEPQSVDPIVNKWHYVHLK |
 Top
| |