| Protein: 328776992 XP_623312.2 PREDICTED: sideroflexin-2-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 31.8 | 28 | 40.2 | 0.7910448 | 0.6965174 |
| Brain | 18.7 | 81.3 | 0.2300123 | ||
| Crop | |||||
| Eye | |||||
| Intestine | 21.7* | 78.3 | 0.27713922 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 78.9* | 8.8 | 12.4 | 6.362903 | 0.7096774 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 9.5 | 90.5 | 0.10497238 | ||
| Thoracic muscle | |||||
| Fat body | 14.9 | 29.8 | 55.3 | 0.26943943 | 0.53887886 |
| Malpighian tubules | 29.8 | 42.3 | 27.9 | 1.0681003 | 1.516129 |
| Nerve chord | 10.2 | 60.9 | 28.9 | 0.3529412 | 2.1072664 |
| Poison sac | |||||
| Sting | |||||
| Heart | 6 | 57 | 37 | 0.16216215 | 1.5405406 |
| Hypopharyngeal gland | 75.2 | 24.8 | 3.032258 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 25.9 | 38 | 47.7 | 0.5429769 | 0.7966457 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MREERVNIDGPLWDLSTFVGRWKHFAWVTDFRTCVTPESKLLEAKKLCEDYKLGKEPAGT TWEQIIYAKKLYESAFHPDTGDLQNVFGRMSFQVPGGMAITGVMLQFYRTTTAVVFWQWV NQSFNALVNYTNRNANSPTTVNQLAVAYISATSAAMITAIGCKSFWAKRANPLMARYVPF AAVAAANCVNIPLMRQNEITKAIEISDENGNKLTKSKLAAVKGISQVVISRIVMCAPGML ILPLIMERLEKYAWMQKIKPLHGPIQVLLVGCFLTFMVPTACALFPQNCSIKSSTLERWE PENYELLKKNCKNREIPIYLYFNKGL |
 Top
| |