| Protein: 66556287 XP_625098.1 PREDICTED: v-type proton ATPase subunit E isoform 3 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 28.2 | 34.1 | 37.7 | 0.74801064 | 0.9045093 |
| Scape | 29 | 35.5 | 35.5 | 0.8169014 | 1 |
| Brain | 44.8 | 19.4 | 35.8 | 1.2513967 | 0.54189944 |
| Crop | 46.3 | 27.3 | 26.4 | 1.7537879 | 1.0340909 |
| Eye | 40.1 | 26.6 | 33.3 | 1.2042042 | 0.7987988 |
| Intestine | 36.2 | 28.6 | 35.2 | 1.0284091 | 0.8125 |
| Leg, front | 38.3 | 29.3 | 32.5 | 1.1784616 | 0.9015385 |
| Leg, middle | 42.4 | 29.1 | 28.5 | 1.4877193 | 1.0210526 |
| Leg, rear | 31.2 | 34 | 34.8 | 0.8965517 | 0.9770115 |
| Mandibular gland | 46.6 | 53.4 | 0.87265915 | ||
| Rectum | 86.9* | 13.1 | 6.633588 | ||
| Salivary gland, cerebral | 28.1 | 12.8 | 59.1 | 0.47546533 | 0.21658206 |
| Salivary gland, thoracic | 50.5 | 11 | 38.5 | 1.3116883 | 0.2857143 |
| Sternite | 31.3 | 28.5 | 40.2 | 0.77860695 | 0.7089552 |
| Tergite | 28 | 42.6 | 29.3 | 0.9556314 | 1.4539249 |
| Ventriculus | 14.2 | 36 | 49.8 | 0.28514057 | 0.72289157 |
| Thoracic muscle | 40.4 | 59.6 | 0.67785233 | ||
| Fat body | 52.6 | 24.1 | 23.3 | 2.2575107 | 1.0343348 |
| Malpighian tubules | 33.5 | 30 | 36.5 | 0.91780823 | 0.82191783 |
| Nerve chord | 23.3 | 34.1 | 42.6 | 0.5469484 | 0.80046946 |
| Poison sac | 63.8 | 36.2 | 1.7624309 | ||
| Sting | 60.8 | 39.2 | 1.5510204 | ||
| Heart | 32 | 29 | 38.9 | 0.8226221 | 0.7455013 |
| Hypopharyngeal gland | 47.7 | 52.3 | 0.9120459 | ||
| Galea | 35.6 | 33.1 | 31.4 | 1.133758 | 1.0541401 |
| Glossa | 33.3 | 25.6 | 41.1 | 0.810219 | 0.62287104 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.7 | 34.6 | 37.9 | 0.9419525 | 0.91292876 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MALSDADVQKQINHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYYEKK EKQVELQKKIQSSNMLNQARLKVLKVREDHVRNVLDEARKRLGEVTRDISRYREILKLLI VQGLCQLTENHVTIRVRQVDLPLVESLLDSVQNAYKQITKKDVTIKVDQDNFLPSDSCGG VDLFAAKGRIKVSNTLETRLELIAQQLIPDIRSALFGCNPNRKFID |
 Top
| |