| Protein: 209969778 NP_001129659.1 heat shock factor binding protein 1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 5.1* | 68.5* | 26.4 | 0.19318181 | 2.594697 |
| Scape | 50 | 50 | 1 | ||
| Brain | 33.2 | 66.8 | 0.497006 | ||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 2.5 | 63.9 | 33.7 | 0.07418398 | 1.8961425 |
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 61 | 39 | 1.5641025 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | 30.6 | 33.1 | 36.2 | 0.8453039 | 0.91436464 |
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.8 | 49.7 | 42 | 0.7095238 | 1.1833333 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MADIKQDHKGEDTDNYGIGNNAEPKNMQELTEYVQTLLQNMQGKFQTMSDQILGKIDEMG NRIDDLEKNITDLMTQAGVEGGDK |
 Top
| |