| Protein: 66507594 XP_624164.1 PREDICTED: trifunctional enzyme subunit beta mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 8.6* | 59.8 | 31.6 | 0.2721519 | 1.892405 |
| Scape | 26.9 | 34.5 | 38.6 | 0.6968912 | 0.8937824 |
| Brain | 73.7* | 26.3 | 2.8022814 | ||
| Crop | 17 | 59* | 23.9 | 0.7112971 | 2.4686193 |
| Eye | |||||
| Intestine | 28.1 | 37.4 | 34.5 | 0.81449276 | 1.0840579 |
| Leg, front | 27.5 | 35.9 | 36.5 | 0.75342464 | 0.98356164 |
| Leg, middle | 40.2 | 29.2 | 30.6 | 1.3137255 | 0.95424837 |
| Leg, rear | 66.8 | 15.6 | 17.6 | 3.7954545 | 0.8863636 |
| Mandibular gland | |||||
| Rectum | 21.5 | 42.1 | 36.4 | 0.5906593 | 1.1565934 |
| Salivary gland, cerebral | 89.6 | 4.3 | 6.1 | 14.688524 | 0.704918 |
| Salivary gland, thoracic | 26.3 | 35.8 | 37.9 | 0.6939314 | 0.94459105 |
| Sternite | 14.1 | 33.5 | 52.4 | 0.26908398 | 0.639313 |
| Tergite | 10.9 | 48.8 | 40.4 | 0.26980197 | 1.2079208 |
| Ventriculus | 3.4* | 96.6 | 0.035196688 | ||
| Thoracic muscle | 13.6 | 76.5 | 9.9 | 1.3737373 | 7.7272725 |
| Fat body | 12.4 | 47.1 | 40.5 | 0.30617285 | 1.1629629 |
| Malpighian tubules | 33.9 | 28.8 | 37.3 | 0.9088472 | 0.772118 |
| Nerve chord | 29.7 | 22 | 48.3 | 0.61490685 | 0.45548654 |
| Poison sac | |||||
| Sting | 61.8 | 38.2 | 1.6178011 | ||
| Heart | 18.6 | 32.9 | 48.5 | 0.38350517 | 0.6783505 |
| Hypopharyngeal gland | 75 | 25 | 3 | ||
| Galea | 65.4 | 34.6 | 1.8901734 | ||
| Glossa | 56.7 | 43.3 | 1.3094689 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32 | 40.8 | 36.3 | 0.8815427 | 1.1239669 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFFLVKNKFLMKGGFPKYGSIIKYLKTNNKLYATKSNVTKNIVFIDGVRTPFLHSGTSYK NLMAYDLARHSLVALQKKIKFPKEIVEYIVYGTVIQEVKTSNIAREAALTAGYSDRIPAH TVTMACISSNQALTTGMGLIACGVYDVIIAGGVEFLSDIPIRHSRHMRTLMLQANKAKTI GEKLTLFTSIRAAHFVPDLPAVAEFSSNETMGHSSDRLAAAFGISRKEQDEYALRSHTLA AKAQQQGYLTDIVPYKIPNVNEVINKDNGIQVSTKEKLAKLKPAFVKPYGTVTAANSSFL TDGASAALIMTEEKALQLGLTPKAYLRNFIYVSQDPIDQLLLGPSYAIPQVLQKAKLNVK DIGVWEIHEAFAGQILANLKALDSDLFAQKYLGRSLKVGIPDLNKWNAWGGSLSIGHPFA ATGIRLASHTANRLIKEDQQFGLIAACAAGGQGVGMIMERYPGAKV |
 Top
| |