| Protein: 328779623 XP_624590.2 PREDICTED: fumarylacetoacetase |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 32.5 | 34.6 | 32.9 | 0.98784196 | 1.0516717 |
| Scape | 21.2 | 44.8 | 34 | 0.62352943 | 1.3176471 |
| Brain | 62 | 38 | 1.6315789 | ||
| Crop | 17.8* | 82.2 | 0.21654502 | ||
| Eye | |||||
| Intestine | 66.1 | 33.9 | 1.9498525 | ||
| Leg, front | 28 | 47.6 | 24.4 | 1.1475409 | 1.9508197 |
| Leg, middle | 50.4 | 49.6 | 1.016129 | ||
| Leg, rear | 29 | 42.1 | 28.8 | 1.0069444 | 1.4618056 |
| Mandibular gland | 8 | 92 | 0.08695652 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 90* | 3.7 | 6.2 | 14.516129 | 0.5967742 |
| Sternite | 20.5 | 62 | 17.5 | 1.1714286 | 3.5428572 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 39.4 | 9.9 | 50.7 | 0.7771203 | 0.19526628 |
| Malpighian tubules | 21.4 | 60 | 18.5 | 1.1567568 | 3.2432432 |
| Nerve chord | 30.6 | 55.1 | 14.3 | 2.1398602 | 3.8531468 |
| Poison sac | |||||
| Sting | 24.3 | 75.7 | 0.32100397 | ||
| Heart | 24.5 | 29.7 | 45.8 | 0.5349345 | 0.6484716 |
| Hypopharyngeal gland | 70.5 | 29.5 | 2.3898306 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33 | 42 | 39.7 | 0.8312343 | 1.0579345 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKSFVEYSSDCDFPIENLPYGVFSTKNNPQKRIGVAIGEEILDLSAIAHLFDGPLLKNKQ DVFRRDYLNDFMALGRSAWIEARNKLQDLLSISNPTLQESNIRSNAFVKQNEATMHLPAK IGDYTDFYSSIYHATNVGIMFRGKENALMPNWKHLPVAYHGRASSVVVSGTPIRRPLGQT VPIEDADPVFGPSRLVDFELEVAIFVGGPPTNLGDAVPASKAYDHIFGMVTMNDWSARDI QKWEYIPLGPFGAKNFGTTISPWIVTMEALEPFKVPNVHQNPTPFPYLQHNESCNFDIKL EVDIKCKRFVKKRKLLFTKTKKKGEIVSYFFITFQAADSFGSMLELSWKGTRPILLKDGT SRKFLQDDDEVIIRGYCVGDGYRIGFGSCSGKLLPALTK |
 Top
| |