| Protein: 110750766 XP_001120194.1 PREDICTED: protein lethal(2)essential for life-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 4.8 | 87.6* | 7.5 | 0.64 | 11.68 |
| Scape | 38.5 | 29.7 | 31.8 | 1.2106918 | 0.9339623 |
| Brain | 37.6 | 62.4 | 0.6025641 | ||
| Crop | 18.9 | 32.7 | 48.4 | 0.39049587 | 0.67561984 |
| Eye | 91.1* | 4.9 | 4 | 22.775 | 1.225 |
| Intestine | 49 | 51 | 0.9607843 | ||
| Leg, front | 23.6 | 28.2 | 48.2 | 0.48962656 | 0.58506227 |
| Leg, middle | 23.9 | 29.9 | 46.2 | 0.51731604 | 0.64718616 |
| Leg, rear | 23.4 | 33.9 | 42.7 | 0.5480094 | 0.793911 |
| Mandibular gland | 89.9* | 10.1 | 8.9009905 | ||
| Rectum | |||||
| Salivary gland, cerebral | 30.4 | 22.1 | 47.5 | 0.64 | 0.46526316 |
| Salivary gland, thoracic | 54.8 | 24.5 | 20.7 | 2.647343 | 1.1835749 |
| Sternite | 88* | 8.1 | 3.9 | 22.564102 | 2.0769231 |
| Tergite | 90.4 | 4 | 5.6 | 16.142857 | 0.71428573 |
| Ventriculus | |||||
| Thoracic muscle | 60.6 | 39.4 | 1.538071 | ||
| Fat body | 75.5 | 12.2 | 12.3 | 6.1382113 | 0.9918699 |
| Malpighian tubules | 67.7* | 8.9 | 23.4 | 2.8931625 | 0.3803419 |
| Nerve chord | 58.1 | 11.7 | 30.2 | 1.9238411 | 0.38741723 |
| Poison sac | |||||
| Sting | 13.4 | 86.6 | 0.15473442 | ||
| Heart | 48.9 | 18.8 | 32.2 | 1.5186335 | 0.5838509 |
| Hypopharyngeal gland | 90.1 | 9.9 | 9.10101 | ||
| Galea | 18.2 | 26.9 | 54.9 | 0.33151183 | 0.48998177 |
| Glossa | 27.3 | 28.7 | 44 | 0.62045455 | 0.6522727 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 49.2 | 28.7 | 33.2 | 1.4819278 | 0.86445785 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSLIPLLFSDWWEDLDRPHRLLDQNFGLGLYPEQLLNSNILDQYILPNRNQRLRNPLIYY RPWGELLRKNEGGGTSTVKADKDKFQVILDVQQFKPDEINVKIVDKCVVVEGKHEEKQDE HGWISRQFTRRYMIPEQCDIDQVTSSLSSDGVLNITAPRKEQPKIQNERNITIEQTGKPA LKENTEEKKEEKKEEN |
 Top
| |