| Protein: 110757116 XP_001121522.1 PREDICTED: mitochondrial import inner membrane translocase subunit Tim13-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 72.2* | 17.1 | 10.7 | 6.7476635 | 1.5981308 |
| Scape | 32.4 | 36.4 | 31.2 | 1.0384616 | 1.1666666 |
| Brain | 51.8 | 48.2 | 1.0746888 | ||
| Crop | 31.2 | 31.3 | 37.5 | 0.832 | 0.83466667 |
| Eye | |||||
| Intestine | 33.2 | 30.4 | 36.4 | 0.9120879 | 0.83516484 |
| Leg, front | 62.1 | 37.9 | 1.6385224 | ||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 2.9 | 60.9 | 36.2 | 0.0801105 | 1.6823205 |
| Rectum | |||||
| Salivary gland, cerebral | 32.4 | 30.3 | 37.3 | 0.86863273 | 0.81233245 |
| Salivary gland, thoracic | 49.1 | 22.7 | 28.2 | 1.7411348 | 0.80496454 |
| Sternite | 31 | 35.3 | 33.7 | 0.9198813 | 1.0474777 |
| Tergite | 26.7 | 56.8 | 16.6 | 1.6084337 | 3.4216866 |
| Ventriculus | |||||
| Thoracic muscle | 7.3 | 79.7 | 12.9 | 0.56589144 | 6.1782947 |
| Fat body | 15 | 71.8* | 13.2 | 1.1363636 | 5.439394 |
| Malpighian tubules | 34.3 | 33 | 32.7 | 1.0489297 | 1.0091743 |
| Nerve chord | 31.8 | 19.8 | 48.4 | 0.6570248 | 0.4090909 |
| Poison sac | |||||
| Sting | 49.4 | 50.6 | 0.97628456 | ||
| Heart | 50.4 | 24.9 | 24.7 | 2.0404859 | 1.0080972 |
| Hypopharyngeal gland | 70.5 | 29.5 | 2.3898306 | ||
| Galea | 21.5 | 47 | 31.5 | 0.6825397 | 1.4920635 |
| Glossa | 20.7 | 33.8 | 45.4 | 0.45594713 | 0.74449337 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.8 | 43.2 | 32.1 | 0.95950156 | 1.3457944 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSALTSESLTDKEKSEFMQQIKQEFAIASAQEMLSKMSEKCFKKCVVRPGTSLDSSEQKC VAMCMDRYMDAFNLVSKTYSARIQREHNRM |
 Top
| |