| Protein: 328778689 XP_001123353.2 PREDICTED: probable enoyl-CoA hydratase mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 35 | 35.2 | 29.8 | 1.1744967 | 1.181208 |
| Scape | 34.8 | 36.2 | 29 | 1.2 | 1.2482759 |
| Brain | 32.5 | 48.5* | 19 | 1.7105263 | 2.5526316 |
| Crop | 19.2 | 34.6 | 46.2 | 0.41558442 | 0.74891776 |
| Eye | 78.4* | 21.6 | 3.6296296 | ||
| Intestine | 34 | 35.2 | 30.7 | 1.1074919 | 1.1465799 |
| Leg, front | 36.2 | 36.3 | 27.5 | 1.3163637 | 1.32 |
| Leg, middle | 34.3 | 36.9 | 28.8 | 1.1909722 | 1.28125 |
| Leg, rear | 61.5 | 24.9 | 13.6 | 4.522059 | 1.8308823 |
| Mandibular gland | 26.9 | 36.8 | 36.3 | 0.74104685 | 1.0137742 |
| Rectum | 21.8 | 58.9 | 19.3 | 1.1295336 | 3.0518134 |
| Salivary gland, cerebral | 91.4* | 6.1 | 2.6 | 35.153847 | 2.3461537 |
| Salivary gland, thoracic | 9.6* | 49.4 | 41 | 0.23414634 | 1.2048781 |
| Sternite | 23.8 | 50.4 | 25.8 | 0.92248064 | 1.9534883 |
| Tergite | 9.1 | 63.6 | 27.3 | 0.33333334 | 2.3296704 |
| Ventriculus | 4.5 | 10.5* | 85 | 0.052941177 | 0.12352941 |
| Thoracic muscle | 98.3* | 1.7 | 57.82353 | ||
| Fat body | 12.7 | 50.2 | 37.1 | 0.34231806 | 1.3530997 |
| Malpighian tubules | 31.9 | 37.6 | 30.5 | 1.0459017 | 1.2327869 |
| Nerve chord | 38.3 | 34.4 | 27.3 | 1.4029304 | 1.2600733 |
| Poison sac | |||||
| Sting | 48.1 | 51.9 | 0.92678225 | ||
| Heart | 21.1 | 35.1 | 43.9 | 0.48063782 | 0.7995444 |
| Hypopharyngeal gland | 84.4 | 15.6 | 5.4102564 | ||
| Galea | 37.9 | 29.6 | 32.5 | 1.1661538 | 0.9107692 |
| Glossa | 40 | 23.3 | 36.7 | 1.0899183 | 0.6348774 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.3 | 43.3 | 30.4 | 1.0296053 | 1.4243422 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTILRIGKILFVKQVQIGRKPQYFASDTKYYCSYVPQNYEFIKVETAGEKKNIGLITLNR PKALNALCEKLITELNDAMLKFDTNNNIGAIIITGSEKAFAAGADIKEMKNNTFAYNIRN KFLNNWNISEISKPVIAAVNGYALGGGCELAMMCDIIYAGDTAKFGQPEITIGTIPGAGG TQRLTRIIGKSKAMEMVLTGKQINAEEAEKNGLVSKIFPANKLIAEAIKLGEKIASHSQL IVAMAKESVNIAYETTLKEGLHFEKNIFHGTFATDDRKEGMTAFIEKRSPKFNNQ |
 Top
| |