| Protein: 328794387 XP_001123196.2 PREDICTED: selenium-binding protein 1-B-like partial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 14.5 | 57.3 | 28.2 | 0.5141844 | 2.031915 |
| Scape | |||||
| Brain | 41.5 | 58.5 | 0.7094017 | ||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 81.4* | 18.6 | 4.376344 | ||
| Leg, middle | 84.5* | 15.5 | 5.451613 | ||
| Leg, rear | 92.2* | 7.8 | 11.820513 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | 6.8 | 63.7 | 29.5 | 0.23050848 | 2.159322 |
| Ventriculus | 51.5 | 48.5 | 1.0618557 | ||
| Thoracic muscle | |||||
| Fat body | 66.5 | 33.5 | 1.9850746 | ||
| Malpighian tubules | 32.9 | 29.2 | 37.9 | 0.8680739 | 0.77044857 |
| Nerve chord | 10.8 | 73.8* | 15.3 | 0.7058824 | 4.8235292 |
| Poison sac | |||||
| Sting | 63.6 | 36.4 | 1.7472527 | ||
| Heart | 13.6 | 50.2 | 36.1 | 0.3767313 | 1.3905817 |
| Hypopharyngeal gland | 25.6 | 74.4 | 0.34408602 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 28.5 | 57.4 | 33.9 | 0.84070796 | 1.6932154 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
IIHKLRMPHIGDELHHSGWNICSSCHNKQQKRDTLILPCLMSDRVYFIDTSSERTPSIKK VLSSIEVNQYGISTLHTSHCLPTGEILISAMGKPNGDAIGEFLCVNAETLEMKGTWTIGE KKAAFGYDFWYQPYHDVLVASEWALPRVFKKGYATTDIADPAIYGRSLNFYSWNERKLKQ VLNLGEDGIAPLEVRFLHNPKSSEGFVGCAVTSNVYKFYKTSNGEWAAKKVIQILNKQVE GWITPQMPGIY |
 Top
| |