| Protein: 48126576 XP_393285.1 PREDICTED: cAMP-dependent protein kinase catalytic subunit isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 48.8 | 51.2 | 0.953125 | ||
| Scape | 44.9 | 14.7 | 40.4 | 1.1113862 | 0.36386138 |
| Brain | 22.8 | 77.2 | 0.29533678 | ||
| Crop | 51.5 | 48.5 | 1.0618557 | ||
| Eye | |||||
| Intestine | 58.6 | 41.4 | 1.4154589 | ||
| Leg, front | 35.1 | 28.2 | 36.7 | 0.95640326 | 0.7683924 |
| Leg, middle | 37.4 | 26.5 | 36.1 | 1.0360111 | 0.734072 |
| Leg, rear | 30.4 | 25.4 | 44.2 | 0.6877828 | 0.57466066 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 54.9 | 19.5 | 25.6 | 2.1445312 | 0.76171875 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 79.3 | 20.7 | 3.8309178 | ||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | 5.6 | 72.1 | 22.3 | 0.25112107 | 3.2331839 |
| Poison sac | |||||
| Sting | |||||
| Heart | 17.3* | 82.7 | 0.20918985 | ||
| Hypopharyngeal gland | 66.3 | 33.7 | 1.9673591 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.7 | 40.2 | 43.1 | 0.85150814 | 0.93271464 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGNNAATANKKVDAAESVKEFLDKAKKEFEDKWKRNPTNTAGLDDFERIKTLGTGSFGRV MIVQHKPTGEYYAMKILDKQKVVKLKQVEHTLNEKRILQAISFPFLVSLRFHFKDNSYLY MVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQ GYLKVTDFGFAKRVQGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPP FFADQPIQIYEKIVSGKPRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKGHKWF ASTDWIAVFQKKIEAPFIPKCKGPGDTSNFDDYEEETLRISLTEKCAKEFAEF |
 Top
| |