| Protein: 328793755 XP_001122233.2 PREDICTED: uroporphyrinogen decarboxylase |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 53 | 47 | 1.1276596 | ||
| Scape | 31.3 | 6.7* | 62.1 | 0.50402576 | 0.1078905 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 15.8 | 84.2 | 0.18764846 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 29.9 | 50.4 | 19.8 | 1.510101 | 2.5454545 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 55.4 | 44.6 | 1.2421525 | ||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 38.3 | 34.5 | 27.2 | 1.4080882 | 1.2683823 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.7 | 36.7 | 47.5 | 0.70947367 | 0.7726316 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTQMKFPPLKNDLILKAIRGESTERIPIWIMRQAGRYLPEFQEIRSKHDFFSICQTPTLA CEVTLQPIKRFDLDAGIIFSDILVIPQAMGLTVEMIPGMGPVLPKPLKDPTDLVRLIQPN VEKDLKYVGDAITLTRYKLEGKVPLIGFTGAAWTLMSYMIQGGGSSTMIRAREWLYKYPD DSHKLLQLITNVIIDYLVMQVKAGAQXXXXXXXEIYSFKYLKEISEKVRQRLKKENIPEV PMIAFPKGATINSLEMLAKSKTYEVLGLDWTIDPIEARKKFGSEIILQGNFDPCALYGSE QEIINRAKDMALKFGKIRYIANLGHGILPDTPIASVTAFIKGIHSI |
 Top
| |