| Protein: 66554647 XP_395200.2 PREDICTED: trimeric intracellular cation channel type B-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 48.2 | 13.6 | 38.2 | 1.2617801 | 0.35602093 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 37.2 | 62.8 | 0.5923567 | ||
| Salivary gland, thoracic | 65.5 | 34.5 | 1.8985507 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 86.7* | 13.3 | 6.518797 | ||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 30.8 | 69.2 | 0.44508672 | ||
| Heart | 30 | 70 | 0.42857143 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 47.9 | 42.1 | 48 | 0.99791664 | 0.87708336 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDPEAFLDMANQVIKLKMFPYFDIAHCVLCALHVREDLGPGAQAFSRKHPLSCWLSTMLV VFASGMLCNGLLGEPILAPLKNTPQVIVATIVWYVIFYTPFDIGYKIAKFLPVKIVCATM KEIYRCKKVYDGVTHAGKLYPNAYLIMVLIGTLKGNGAGFTKLFERLIRGVWTPTAMEFM QPSFPTKASMVASIIFVLDKKTDLISAPHALVYFGIVIFFVYFKLSSILLGIHDPFVPFE NLFCALFLGGIWDSLAKLLGRGQAKDEKADAKKKD |
 Top
| |