| Protein: 66531797 XP_397323.2 PREDICTED: ubiquitin-40S ribosomal protein S27a |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 41.3 | 26.1 | 32.6 | 1.2668712 | 0.8006135 |
| Scape | 30 | 32.6 | 37.4 | 0.80213904 | 0.8716577 |
| Brain | 51.1 | 17.1 | 31.8 | 1.6069182 | 0.5377358 |
| Crop | 50.4 | 13.2 | 36.5 | 1.380822 | 0.36164385 |
| Eye | 27.9 | 30.4 | 41.7 | 0.66906476 | 0.7290168 |
| Intestine | 43.2 | 34.4 | 22.4 | 1.9285715 | 1.5357143 |
| Leg, front | 37.8 | 30.7 | 31.6 | 1.1962025 | 0.971519 |
| Leg, middle | 33.6 | 32.1 | 34.2 | 0.98245615 | 0.9385965 |
| Leg, rear | 38.3 | 26.4 | 35.2 | 1.0880681 | 0.75 |
| Mandibular gland | 27 | 57.1 | 15.9 | 1.6981132 | 3.5911949 |
| Rectum | 37.4 | 22.2 | 40.4 | 0.92574257 | 0.54950494 |
| Salivary gland, cerebral | 58.7 | 33.9* | 7.4 | 7.9324327 | 4.581081 |
| Salivary gland, thoracic | 35.3 | 27.4 | 37.3 | 0.9463807 | 0.73458445 |
| Sternite | 37.9 | 22.9 | 39.2 | 0.96683675 | 0.5841837 |
| Tergite | 32.8 | 40.9 | 26.3 | 1.2471483 | 1.5551331 |
| Ventriculus | 39.3 | 44.3 | 16.4 | 2.3963416 | 2.7012196 |
| Thoracic muscle | 59.9 | 40.1 | 1.4937656 | ||
| Fat body | 22 | 35.5 | 42.5 | 0.5176471 | 0.8352941 |
| Malpighian tubules | 33.5 | 25.7 | 40.9 | 0.8190709 | 0.6283619 |
| Nerve chord | 36.3 | 23.5 | 40.2 | 0.9029851 | 0.58457714 |
| Poison sac | |||||
| Sting | 67.7 | 32.3 | 2.0959752 | ||
| Heart | 32.2 | 34.9 | 32.9 | 0.9787234 | 1.0607903 |
| Hypopharyngeal gland | 8.3 | 91.7 | 0.090512544 | ||
| Galea | 10.6 | 68.3* | 21.1 | 0.50236964 | 3.2369668 |
| Glossa | 25.6 | 40.8 | 33.6 | 0.7619048 | 1.2142857 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.6 | 33.2 | 34.5 | 1.0608696 | 0.96231884 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPGQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGAKKRKKKNYSTPKKIKHKKKKVKLAVLKFYKVDENGKIHRLRRE CPMEQCGAGVFMAAMEDRHYCGKCGYTLVFNKPEDK |
 Top
| |