| Protein: 328787541 XP_393321.4 PREDICTED: proteasome subunit beta type-6-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 43.7 | 24.2 | 32.1 | 1.3613707 | 0.7538941 |
| Scape | 38.7 | 26.6 | 34.7 | 1.1152738 | 0.7665706 |
| Brain | 47.3 | 52.7 | 0.8975332 | ||
| Crop | 30.1 | 33.4 | 36.5 | 0.82465756 | 0.9150685 |
| Eye | |||||
| Intestine | 39.2 | 30.5 | 30.3 | 1.2937294 | 1.0066006 |
| Leg, front | 39.2 | 32.8 | 28.1 | 1.3950177 | 1.1672598 |
| Leg, middle | 58.8 | 41.2 | 1.4271845 | ||
| Leg, rear | 43.1 | 31.3 | 25.6 | 1.6835938 | 1.2226562 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 39.3 | 28.6 | 32.1 | 1.2242991 | 0.89096576 |
| Sternite | 35.1 | 36.3 | 28.7 | 1.2229965 | 1.2648084 |
| Tergite | 35 | 65 | 0.53846157 | ||
| Ventriculus | 47.1 | 23.3 | 29.7 | 1.5858586 | 0.7845118 |
| Thoracic muscle | |||||
| Fat body | 14.6 | 46.3 | 39 | 0.37435898 | 1.1871794 |
| Malpighian tubules | 27.3 | 32.3 | 40.5 | 0.67407405 | 0.7975309 |
| Nerve chord | 30.4 | 32.4 | 37.3 | 0.8150134 | 0.86863273 |
| Poison sac | |||||
| Sting | 48.4 | 51.6 | 0.93798447 | ||
| Heart | 6.7 | 56.2 | 37.1 | 0.180593 | 1.5148247 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.2 | 35.3 | 37.8 | 0.93121696 | 0.93386245 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAQMVDNFAQSHIGSVTDNLVQDWVSSEQSTGTSIMACEFDGGVVIGADSRATTGAYISN RFADKLTKITDYIYCCRSGSAIEPLVETAANVFRELCYNYRDSLMAGILVAGWDSRKGGQ VYSVPIGGMCVRQPISIGGSGSTYVYGYMDSQYKPNMSKNECVKLVENTLALAMSRDGSS GGVIRIGVITNKGIERKVILGNELPRFYEG |
 Top
| |